KEGG   Streptomyces coelicolor: SCO7332Help
Entry
SCO7332           CDS       T00085                                 

Gene name
glgBII
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sco  Streptomyces coelicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO7332 (glgBII)
Enzymes [BR:sco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCO7332 (glgBII)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO7332 (glgBII)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(8143094..8145319)
Genome map
AA seq 741 aa AA seqDB search
MALRDTSIPEPSGPVPPAPGACATAPPLDPTDRGRLLAGAHHDPHSLLGAHPVPGGIAFR
VLRPFAREVGVVVDGERHTLASEEDGLFSGVLPLAGIPSYTLVVAYEQGETQETHDPYRF
LPALGELDLHLIGEGRHEQLWQALGAEPMTHEGVTGTRFTVWAPNAQGVRVATDFTHWDG
TAFPMRSLGSSGVWELFLPGVGEGTRYKFEIHSRYGHRFLKADPMARAAEEPPNTASVVT
ASRYEWGDAQWMRTRADTPVHEAPFSVYEVHLPSWRPGLTYRELAEELPAYVKDLGFTHV
ELMPVAEHPYGPSWGYQVTGFYAPTARLGSPDDFRFLVDALHRAGIGVIMDWVPAHFPKD
DWALGRFDGDPLYEPGDSRRAEHPDWGTYTFDFARTEVRNFLVANAVYWCEEFHIDGLRV
DAVASMLYLDYSRDSGQWEPNQYGGREDLAAMAFLQEMNATVYRRCPGVVTIAEESTAWG
GVTRPTDTGGLGFGLKWNMGWMHDSLEYVAHEPVHRRYHHHEMTFSMVYAYSENYVLPIS
HDEVVHGKQALVSKMPGDWWQRRANVRAYLGFMWAHPGKQLLFMGQEFAQGAEWSEKQGP
EWWLLDEGYHSAGDHRGVQDLVRELNTRYTRTPALWQRDTDPAGFRWVSVDAAEDNVFAF
LRYGTDGTPLLAVSNFSPVVRHEYGLAVGDEAVAWQEVLNTDAEEYGGGGVGNPDPVKPE
DGSIRITLPPLATVWLMPYAL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtggccctccgcgacacctcgatccccgagccgtccggtcccgtcccgcccgcacccggt
gcgtgcgcgaccgcgccgcccctggaccccaccgaccgggggcgcctgctggcgggcgcc
caccacgacccgcactccctgctgggcgcccatccggtgcccggcggcatcgccttccgg
gtgctgcgccccttcgcccgcgaggtgggtgtggtcgtggacggcgagcgccacaccctg
gcgtcggaggaggacggcctgttctccggtgtgctgccgctcgccgggatcccgtcgtac
acgctggtggtggcctacgagcagggcgagacgcaggagacgcacgacccgtaccgcttc
ctgcccgccctcggcgagctggacctgcacctgatcggcgagggccggcacgagcagctg
tggcaggccctcggcgccgagccgatgacgcacgagggggtcaccggcacccggttcacg
gtgtgggcgccgaacgcccagggcgtgcgggtcgccaccgacttcacgcactgggacggc
accgcgttcccgatgcgttcgctgggttcgtccggggtctgggagctgttcctgccgggc
gtcggcgagggcacccggtacaagttcgagatccactcgcggtacggccaccggttcctg
aaggccgacccgatggcccgcgcggccgaggagccgccgaacaccgcgtccgtggtgacc
gcctcgcgctacgagtggggcgacgcccagtggatgcggacccgcgccgacacgcccgtg
cacgaggcgccgttctcggtgtacgaggtgcacctgccgtcctggcggccgggcctgacc
taccgcgagctggccgaggagctgcccgcctacgtcaaggacctgggcttcacccacgtc
gagctgatgccggtcgcggagcacccctacgggccgtcctggggctaccaggtcaccggc
ttctacgcgccgaccgcgcgcctcggctcgccggacgacttccgcttcctggtcgacgcg
ctgcaccgggccggaatcggcgtgatcatggactgggtgccggcgcacttcccgaaggac
gactgggcactgggccgcttcgacggcgacccgctgtacgagcccggggactcccggcgc
gcggagcacccggactggggcacgtacaccttcgacttcgcgcggaccgaggtgcgcaac
ttcctcgtggcgaacgccgtgtactggtgcgaggagttccacatcgacgggctgcgggtg
gacgcggtcgcctcgatgctctacctggactactcgcgcgactccggccagtgggagccc
aaccagtacggcggccgggaggacctggcggccatggccttcctccaggagatgaacgcg
accgtctaccggcgctgccccggcgtggtgaccatcgccgaggagtcgaccgcgtggggc
ggggtgacccggccgaccgacaccggcgggctcggcttcggcctgaagtggaacatgggc
tggatgcacgactcgctggagtacgtcgcccacgagccggtgcaccgcaggtaccaccac
cacgagatgaccttctcgatggtgtacgcgtacagcgagaactacgtgctgccgatctcc
cacgacgaggtggtgcacggcaagcaggcgctggtgtcgaagatgcccggcgactggtgg
cagcggcgggcgaacgtgcgcgcgtacctgggcttcatgtgggcccaccccggcaagcaa
ctgctgttcatggggcaggagttcgcgcagggcgccgagtggtcggagaagcaggggccc
gagtggtggctcctcgacgaggggtaccactcggcgggcgaccaccgcggggtgcaggac
ctggtccgcgagctcaacacccgctacacgcgcactccggccctgtggcagcgcgacacc
gacccggccggcttccggtgggtctcggtggacgcggccgaggacaacgtcttcgcgttc
ctgcggtacggcacggacggcactccgctgctggcggtgtccaacttctcccccgtcgtc
cggcacgagtacggactcgccgtcggcgacgaggccgtcgcctggcaggaggtgctcaac
accgacgccgaggagtacggcggcggcggcgtgggcaacccggacccggtgaagccggag
gacgggagcatccggatcacgctgcccccgctggcgactgtgtggctgatgccgtacgcc
ctgtga

DBGET integrated database retrieval system