KEGG   Streptomyces coelicolor: SCO7334Help
Entry
SCO7334           CDS       T00085                                 

Gene name
SC4G10.13c
Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO7334 (SC4G10.13c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SCO7334 (SC4G10.13c)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     SCO7334 (SC4G10.13c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(8146713..8148431)
Genome map
AA seq 572 aa AA seqDB search
MTVNEPVPDTFEDTPAGDRHPDWFKRAVFYEVLVRSFQDSNGDGIGDLKGLTAKLDYLQW
LGVDCLWLPPFFKSPLRDGGYDVSDYTAVLPEFGDLADFVEFVDAAHQRGMRVIIDFVMN
HTSDQHPWFQESRKNPDGPYGDYYVWADDDTRYADARIIFVDTEASNWTHDPVRGQYYWH
RFFSHQPDLNYENPAVQEEMLAALKFWLDLGVDGYRLDAVPYLYAEEGTNCENLPASHAF
LKRVRREIDAQYPDTVLLAEANQWPEDVVDYFGDYSTGGDECHMAFHFPVMPRIFMAVRR
ESRYPVSEILAKTPAIPSGCQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMRANIG
IRRRLATLLDNDRDQIELFTALLLALPGSPILYYGDEIGMGDNIWLGDRDAVRTPMQWTP
DRNAGFSTCDPGRLYLPAIMDPVYGYQVTNVEASMASPSSLLHWTRRMIEIRKQNPAFGL
GTYTELPSSNPAVLAFLREYEDDLVLCVNNFARFAQPTELDLREFAGRHPVELFGGVRFP
AIGELPYLLTLGGHGFYWFRLTRVASRIGRRA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcaacgagcccgtacctgacaccttcgaggacacccccgcgggggaccggcac
ccggactggttcaaacgagccgtcttctacgaggtcctcgtccgctccttccaggacagc
aacggcgacggcatcggtgatctcaagggcctgaccgccaagctggactacctgcaatgg
ctcggcgtggactgcctgtggctcccgcccttcttcaagtcaccgctgcgcgacggcggt
tacgacgtctccgactacaccgccgtgctgccggagttcggcgacctggccgacttcgtg
gagttcgtggacgcggcgcaccagcgcggcatgcgcgtgatcatcgacttcgtcatgaac
cacaccagcgaccagcacccgtggttccaggagtcccgcaagaacccggacggcccctac
ggcgactactacgtctgggccgacgacgacacccggtacgccgacgcccgcatcatcttc
gtcgacaccgaggcctccaactggacccacgacccggtccgcggccagtactactggcac
cggttcttctcccaccagccggacctcaactacgagaacccggccgtgcaggaggagatg
ctcgccgccctgaagttctggctggacctgggcgtggacggctaccgtctcgacgccgtg
ccctacctgtacgccgaggagggcaccaactgcgagaacctgcccgcctcccacgcgttc
ctcaagcgggtgcgccgcgagatcgacgcgcagtacccggacaccgtactgctggccgag
gccaaccagtggccggaggacgtggtcgactacttcggcgactactccacgggcggcgac
gagtgccacatggccttccacttccccgtcatgccccgcatcttcatggccgtgcgccgc
gagtcccgctacccggtctccgaaatcctcgccaagacccccgcgatcccgtccggctgc
cagtggggcatcttcctgcgcaaccacgacgagctgaccctggagatggtcaccgacgag
gaacgcgactacatgtacgcggagtacgccaaggacccgcgcatgcgcgccaacatcggc
atccgccggcggctggccaccctgctggacaacgaccgcgaccagatcgagctgttcacc
gccctgctgctcgccctcccgggatccccgatcctctactacggcgacgagatcggcatg
ggcgacaacatctggctcggcgaccgcgacgccgtgcgcacccccatgcagtggacgccc
gaccgcaacgccggcttctcgacctgtgacccgggccgcctctacctgcccgcgatcatg
gacccggtctacggctaccaggtgacgaatgtcgaggcgtccatggcctcgccctcctcc
ctgctgcactggacccggcgcatgatcgagatccgcaagcagaaccccgccttcggcctc
ggcacctacaccgaactgccctcctccaacccggcggtgctcgccttcctgcgggagtac
gaggacgacctggtgctgtgcgtgaacaacttcgcacggttcgcccagcccaccgagctg
gatctgcgcgagttcgccggacgccatccggtcgagctgttcggcggggtccgcttcccc
gccatcggcgaactgccgtacctgctgaccctcgggggccacggcttctactggttccgg
ctcacccgagtcgcatcccgcatcggccgccgcgcttga

DBGET integrated database retrieval system