KEGG   Streptomyces coelicolor: SCO7362Help
Entry
SCO7362           CDS       T00085                                 

Gene name
SC9H11.16c.
Definition
oxidoreductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCO7362 (SC9H11.16c.)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO7362 (SC9H11.16c.)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO7362 (SC9H11.16c.)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCO7362 (SC9H11.16c.)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO7362 (SC9H11.16c.)
   00626 Naphthalene degradation
    SCO7362 (SC9H11.16c.)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCO7362 (SC9H11.16c.)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(8175571..8176611)
Genome map
AA seq 346 aa AA seqDB search
MKALQYRTIGAPPEVVTVPDPEPGPGQVLLKVTAAGVCHSDIAVMSWPAEGFPYELPLTL
GHEGVGTVAALGAGVTGLAEGDAVAVYGPWGCGTCAKCAEGKENYCLRADELGIRPPGLG
RPGSMAEYLLIDDPRHLVPLDGLDPVAAVPLTDAGLTPYHAIKRSLPKLVPGSTAVVIGT
GGLGHVAIQLLRALTSARVVALDVSEEKLRLARAVGAHEAVLSDAKAADAVREITGGLGA
EAVFDFVGVAPTVQTAGAVAAVEGDVTLVGIGGGSLPVGFGMLPFEVSVNAPYWGSRSEL
TEVLNLARSGAVSVHTETYSLDDAPLAYERLHEGRVNGRAVILPHG
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactgcagtaccgcaccatcggcgccccgcccgaggtcgtcaccgtcccggac
ccggagccgggccccggccaggtgctgttgaaggtgaccgcggccggagtctgccactcc
gacatcgcggtgatgagctggcccgccgagggcttcccgtacgagctgccgctcaccctc
ggccacgagggcgtcggcaccgtggccgcgctcggcgccggggtgacggggctcgccgag
ggcgacgcggtcgccgtgtacgggccctggggctgcggcacctgcgccaagtgcgcggag
ggcaaggagaactactgcctgcgcgccgacgagctgggcatccgtccgccggggctcggg
cgtccggggtccatggccgagtacctgctgatcgacgacccccggcacctggtcccgctg
gacgggctcgacccggtcgcggcggtgccgctcaccgacgccggactgacgccgtaccac
gcgatcaagcggtcgctgcccaagctggtccccggctccaccgcggtggtcatcggcacc
ggtggtctcggccacgtcgccatccagctgctgcgcgccctgacgtccgcccgggtggtc
gccctggacgtcagcgaggagaagctgcgcctcgcccgtgcggtgggcgcgcacgaggcg
gtgctgtcggacgcgaaggccgcggacgcggtgcgcgagatcaccggcggtctcggtgcc
gaggccgtgttcgacttcgtcggcgtggcgcccaccgtgcagaccgccggagccgtcgcg
gccgtcgagggcgatgtcaccctggtcggcatcggcggcggatcgctgcccgtcggcttc
ggcatgctgccgttcgaggtgtcggtcaacgccccctactggggcagccgcagcgagctg
accgaggtgctgaacctggcccgctccggtgccgtgtcggtgcacaccgagacgtactcc
ctggacgacgccccgctcgcctacgagcggctgcacgagggcagggtcaacggccgcgcg
gtgatcctgccccacggctga

DBGET integrated database retrieval system