KEGG   Streptomyces coelicolor: SCO7407Help
Entry
SCO7407           CDS       T00085                                 

Gene name
SC6D11.03c
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SCO7407 (SC6D11.03c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SCO7407 (SC6D11.03c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(8220304..8222349)
Genome map
AA seq 681 aa AA seqDB search
MISTLHSRLHRGADGAPAPRLAYGADYNPEQWPREVWEEDVRLMREAGVNIVSLGIFSWA
RIQPGPDTWDFAWLDEVMDLLHEHGVGVDLATATASPPPWLTTAHPEILPVTDRGETLWP
GARQHWRPTSPVFREHALRLVRKLATRYADHPALVAWHVNNELGCHNVYDYSDDAARAFR
DWLRARYGTTDALNHAWGTAFWSQRYGDWAEVLPPRLAASHPNPTQQLDFKRFSSDALKD
HLRAERDLLRELTPDVPVTTNFMVMPGTKGMNYADWAGEVDFVANDHYVVPHPQARDELS
FSANLTSGIAGGRPWFLMEHSTSAVNWQPVNLAKRPGEMARDSLTHVAHGADAVCFFQWR
QSAAGAEKYHSAMVPHAGADSVLFRAVTSLGDTLKTLAPVAGSEREPAEVGILFDWESRW
ASEQDSHPTSLLDYHQEALDWYSALLSLGVRADVVTTGADLSRHRVLIAPVLHLVPAELA
KDLTRYAEQGGHLVTTYFSGIVDENDHVWLGGYPGALRDLLGIRVEEFGPLPAGQSVELD
GAGSGDLWTDRITVTAPETEVLARYRTGTHTGHPAVTRRPAGRGSAAYVSTRLGADGLAA
LLPRLLEPAGVTSELPASVRGRVEATVRRGAGGRFLFLVNRTDEAVTVPGLTGDVLVGDT
GDEGAVVLAGRGVAVLRTPTP
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgatctccaccctccactcccgcctgcaccgcggggcggacggtgcgcccgccccgcgt
ctcgcctacggcgccgactacaaccccgagcagtggccccgggaggtgtgggaggaggac
gtacggctgatgcgggaggccggggtcaacatcgtgtcgctcggcatcttctcctgggcc
cgcatccagccgggcccggacacctgggacttcgcctggctcgacgaggtgatggacctg
ctgcacgaacacggggtcggcgtcgacctggcgacggccaccgcgtccccgccgccctgg
ctgaccaccgcgcacccggagatcctcccggtcaccgaccggggcgagacgctgtggccg
ggagcacgtcagcactggcgcccgacctcgcccgtcttccgggagcacgccctgcgcctg
gtgcggaagctggccacccgctacgccgaccacccggcgctcgtcgcctggcacgtcaac
aacgagctgggctgccacaacgtctacgactactccgacgacgccgcccgcgccttccgg
gactggctgcgcgcgcggtacggcaccacggacgccctcaaccacgcctggggcacggcg
ttctggtcgcagcgctacggcgactgggcggaggtcctgccgcccaggctcgccgcctcg
cacccgaacccgacccagcagctggacttcaagcgcttctcctcggacgcgctcaaggac
cacctgcgcgcggagcgggacctgctgcgggagctgacgccggacgtcccggtcaccacc
aacttcatggtgatgcccggcaccaagggcatgaactacgcggactgggccggcgaggtc
gacttcgtcgccaacgaccactacgtcgtcccgcacccccaggcccgcgacgagctgtcg
ttctcggcgaacctcaccagcggcatcgcgggcggccgcccgtggttcctgatggagcac
tccaccagcgcggtgaactggcagccggtcaacctggccaaacggccgggcgagatggcc
cgggactcgctgacgcacgtggcgcacggcgccgacgcggtgtgcttcttccagtggcgc
cagtcggcggccggcgccgagaagtaccactcggcgatggtcccgcacgccggtgcggac
agcgtcctgttccgcgcggtgacctcgctcggcgacaccctgaagacgctcgcgccggtc
gccgggagcgagcgggagcccgccgaggtcggcatcctcttcgactgggagtcccggtgg
gccagcgagcaggactcgcaccccacctcgctgctcgactaccaccaggaggcgctcgac
tggtactcggcgctgctctccctgggcgtgcgcgccgacgtcgtcaccaccggcgccgac
ctgagccgccaccgggtgctgatcgcgccggtgctgcacctggtcccggccgagctggcc
aaggacctcacgcgctacgccgagcagggcgggcacctggtcaccacgtacttctcgggc
atcgtggacgagaacgaccacgtctggctgggcggctatccgggcgcgctgcgagacctg
ctcggcatccgcgtcgaggagttcggtccactgcccgccgggcagagcgtggagctggac
ggcgcgggcagcggagacctgtggaccgaccggatcaccgtgaccgcgccggagaccgag
gtcctggcgcgctaccgcaccggcacccatacgggccaccccgccgtcacccggcgtccg
gcgggccgcggctcggccgcctacgtctccacccggctcggcgccgacgggctcgccgcc
ctgctgccgaggctgctggagccggccggggtgaccagcgagctgcccgcctcggtgcgg
ggccgggtcgaggccaccgtgcgccggggcgccgggggacggttcctgttcctggtcaac
cggaccgacgaggccgtgaccgtccccgggctcaccggagacgtcctggtgggcgacacc
ggtgacgagggcgccgtcgtcctggcgggccggggggtcgccgtcctgcgcacgcccacc
ccctag

DBGET integrated database retrieval system