KEGG   Streptomyces coelicolor: SCO7637Help
Entry
SCO7637           CDS       T00085                                 

Gene name
SC10F4.10c
Definition
(RefSeq) endoglucanase
  KO
K01179  endoglucanase [EC:3.2.1.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00500  Starch and sucrose metabolism
sco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCO7637 (SC10F4.10c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SCO7637 (SC10F4.10c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cellulase CBM_2
Motif
Other DBs
NCBI-GeneID: 1103075
NCBI-ProteinID: NP_631677
Kitasato: SCO7637
UniProt: Q9F3Q0
Position
complement(8464939..8466399)
Genome map
AA seq 486 aa AA seqDB search
MRVYGLGPMGFGSAPIALCPLRTRRNALKRLLALLATGVSIVGLTALAGPPAQAATGCKA
EYTITSQWEGGFQAGVKITNLGDPVSGWTLGFTMPDAGQRLVQGWNATWSQSGSAVTAGG
VDWNRTLATGASADLGFVGSGANPAPTSFTLNGATCSGSVTDPPTDPPTDPPATGTPAAV
NGQLHVCGVHLCNQYDRPIQLRGMSTHGIQWFGPCYGDASLDALAQDWKSDLLRVAMYVQ
EDGYETDPAGFTSRVNGLVDMAEDRGMYAVIDFHTLTPGDPNYNLDRARTFFSSVAARNA
DKKNVIYEIANEPNGVSWTAVKSYAEQVIPVIRAADPDAVVIVGTRGWSSLGVSDGANES
EVVNNPVNATNIMYAFHFYAASHKDDYRAAVSRAATRLPLFVSEFGTVSATGGGAVDRSS
SVAWLDLLDQLKISYANWTYSDADEGSAAFRPGTCEGTDYSSSGVLTESGALLKSRISTT
DDFPTS
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtgtacggtctcgggccgatgggctttgggagcgctcccatcgcgttgtgtccg
cttcgcacgaggaggaacgctttgaaacgccttttggccctgctcgcgaccggcgtgtcg
atcgtcggcctgactgcgctcgccggccccccggcacaggccgccaccggctgcaaggcc
gagtacacgatcaccagccagtgggagggcggcttccaggccggggtgaagatcaccaac
ctgggcgatcccgtcagtggctggacgctcgggttcacgatgccggacgccgggcagcgg
ctcgtccagggctggaacgcgacctggtcgcagtccggctccgcggtcaccgccggcggc
gtcgactggaaccgcaccctggccaccggcgcgtcggccgacctggggttcgtgggctcg
ggcgccaatcccgcgcccacgtccttcacgctcaacggcgcgacctgcagcgggtccgtc
accgatccgccgacggacccgccgaccgatccgcccgcgaccgggacaccggccgccgtc
aacggccaactgcacgtctgcggcgtgcatctgtgcaaccagtacgaccgcccgatacag
ctgcgcggcatgagcacgcacggcatccagtggttcggcccgtgctacggcgacgcgtcc
ctggacgccctggcgcaggactggaagtcggacctgctccgcgtcgccatgtacgtccag
gaggacggctacgaaaccgacccggcgggcttcaccagccgggtgaacggcctggtcgac
atggctgaggaccgcggcatgtacgcggtgatcgacttccacacactgacgccgggcgac
ccgaactacaacctcgaccgcgccaggacgttcttctcctccgtagccgcccgcaacgcg
gacaagaagaacgtgatctacgagatcgccaacgagcccaacggggtgagctggacggcc
gtgaagagctacgccgagcaggtcatcccggtgatccgggccgccgacccggacgccgtc
gtcatcgtcggcacccgcggctggtcctcgctgggcgtctcggacggcgccaacgagagc
gaggtggtcaacaacccggtgaacgcgaccaacatcatgtacgcgttccacttctacgcc
gccagccacaaggacgactaccgggcggcggtgagccgagcggccacccgacttcccctg
ttcgtgtcggagttcggcacggtgagcgccaccggcggtggtgcggtggaccggtcgagc
agcgtcgcctggctggatctgctcgaccagctcaagatcagttatgcgaactggacgtat
tccgacgccgacgaggggagcgccgcgttcaggccgggcacctgtgagggcaccgactac
agcagcagtggcgtgctgaccgagtcgggtgctctgctgaagagccgcatcagcaccacc
gacgacttcccgacgagctga

DBGET integrated database retrieval system