KEGG   Streptomyces coelicolor: SCP1.54cHelp
Entry
SCP1.54c          CDS       T00085                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCP1.54c
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCP1.54c
   00650 Butanoate metabolism
    SCP1.54c
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCP1.54c
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCP1.54c
   00622 Xylene degradation
    SCP1.54c
   00621 Dioxin degradation
    SCP1.54c
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCP1.54c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Kitasato_p1: 
UniProt: 
Position
SCP1:complement(55712..56593)
Genome map
AA seq 293 aa AA seqDB search
MTPHARLNTAVLGTGPLGLDLIERIHASPYLNSPLVVGHRPGSRGLAQAADLGCVTRSGG
IDAVLDADRSVDVVFDATNAFAHPAHWDKLADTGAILIDLTPTTTGTLIVPTVNGHQAAH
HQHIGLVSCSGQAALPILHAVTSRHPAAAVEMVATAASASVGRASRLNLDEYLDTTQQAI
RCFTHAPDAKTMINISAATPAPPFRTAITVITADPAPADDIATLTASVEQKMRALVPGYH
VTSCTSEDRTVRVVVEVTATRSRIPVHAGNLEVISAAAIHAAEQRAQHQEAHS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgacgccacacgcccggctgaacaccgccgtcctcgggaccgggcccctcggcctggac
ctgatcgaacgcatccacgcctccccgtacctgaacagcccgctcgtcgtcggccaccgg
cccggcagcaggggcctggcccaggccgccgacctgggctgtgtcacccggtccggcggc
atcgacgccgtcctggacgccgaccgcagcgtcgacgtggtcttcgacgccacgaacgcc
ttcgcccacccggcccactgggacaagctcgccgacaccggcgcaatactcatcgacctg
acgcccaccaccaccggcaccctgatcgtgccgaccgtgaacggccaccaggccgcccac
caccagcacatcggcctcgtctcctgcagcggccaggccgccctgcccatcctccacgcg
gtcacgagccggcacccggccgcagccgtcgagatggtcgccaccgccgccagcgccagc
gtcggccgcgcgagccgcctcaacctcgacgagtacctcgacaccacccagcaggccatc
cgctgcttcacgcatgcgcccgacgccaagaccatgatcaacatctcggcggccacaccg
gcaccaccgttcaggaccgcaatcaccgtcatcaccgccgacccggccccggccgacgac
atcgccacgctcacagcctccgtcgagcagaagatgcgcgccctcgtgcccggctaccac
gtgacgtcctgcacgagcgaggaccgcaccgtccgcgtcgtcgtcgaagtcaccgccacc
cgcagccgcatcccggtccacgccggaaacctcgaagtgatcagcgccgccgccatccac
gccgcagaacagcgcgcccagcaccaggaggcccactcatga

DBGET integrated database retrieval system