KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0124Help
Entry
SCRE_0124         CDS       T02833                                 

Definition
penicillin-binding protein
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:scon00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCRE_0124
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    SCRE_0124
Enzymes [BR:scon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     SCRE_0124
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SCRE_0124
Glycosyltransferases [BR:scon01003]
 Polysaccharide
  Bacterial polysaccharide
   SCRE_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115649..117868
Genome map
AA seq 739 aa AA seqDB search
MKKLSELFEIVVNHFKKDSPERNHQEVTEVEESESHLSRSGKSRKKPISQHPFRRFWRRY
HLTKIVLILGLGFGLVTGGYLFYVAKSTNVNDLQNALKATTSIYDKDGKKAGSLSGQKGT
YVELSKISPNLQHAVIATEDRSFYKNSGINYGRFILAILTAGRSGGGSTITQQLAKNAYL
SQDQTIERKAKEFFLALELTKKYSKKQILTMYLNNSYFGNGVWGVEDASKKYFGVSASQL
TLDQSATLAGMLKGPELYNPLASIKNATNRRNTVLQNMVAAGYINQNTANQAAANGLGSQ
LVDAYTGKSADYRYPSYFDAVINEAVRDYGLTEADIVNNGYRIYTELDQNYQASMQVIYD
RKDLFPQAADGTRAQSGSVALDPKTGGVRALVGQINSTSANFRSFNYATQSARSPGSTIK
PLAVYSPAVDAGWSINKELDNSTTTYGNYTVNNYAGIQSSPTVPMYQALAQSLNIPAVAA
ANELGLKKVFEYGKKFGLNMDKVSQTLGVALGSGVTTNPLQMAQAYSTFANNGVMNDAHL
ITKIENASGQVVKTHKSTSTRVLNRSTTEKMTSMMLGTFTNGTGVYAAPYGYTMAGKTGT
TETNFNPDLSGDQWVIGYTPDVVISQWLGFPKTDENHYLTGTSANEASAIFRSVANSILP
YTRGTKFGDENAYAKNGIAPVDTSGTNNTTNQSDNRSDVLKDVQDKAKNLVDQAKKAIDD
AKIPEKAKNLWDTVKSWFQ
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattgagtgaattatttgaaatagtagtgaatcattttaaaaaggacagtcct
gagcgcaaccatcaagaggtgacagaggtagaagaaagcgaatcgcatttgagccgttct
gggaaaagccgaaaaaagccaatttctcagcatccatttcgtcgattttggcgtcgctat
cacctgacgaagattgttttgattctgggacttggttttggtttggtgacagggggctat
ctcttttatgttgccaaatccactaatgtgaatgatttacagaatgcgttgaaagcaacg
acatcaatttatgataaggacggaaaaaaagcgggcagcttgtcagggcaaaagggaact
tacgtagaattgtccaaaattagtccgaacttacaacatgccgtcattgcgacagaagac
cgttccttttataaaaatagtggtattaactacggtcgttttattctagcaattttaacg
gctgggcgttctggtggtggttctaccattacacaacaattagctaaaaatgcttactta
tctcaggatcagaccattgagcggaaggcaaaagagtttttcctagctttagaattaact
aaaaaatatagtaaaaagcagattctcactatgtacctcaataattcttattttggaaat
ggtgtttggggtgtagaagatgcctctaaaaagtacttcggcgtatctgccagtcagttg
accctcgaccaatctgctactttagcaggaatgctcaaaggaccggaactatataatccg
cttgcttctatcaaaaacgcaacgaatcgacgcaatactgttttacaaaatatggtagca
gcaggttatatcaatcaaaatactgcaaaccaagcagcagcaaacggtttaggtagtcaa
ttggtagatgcttatacaggaaaatcggcagattatcgttatccgtcttactttgatgcg
gttatcaatgaagcagtacgtgattatggcttgacagaagctgatattgtcaataacggc
tatcgcatttacacagagctagatcaaaattatcaagctagcatgcaagtcatttatgac
cgcaaagatttgttcccacaagcagcagatggtacgagggcccaatctggcagcgtagca
ctagaccctaaaacgggaggagttcgtgcgcttgttgggcaaatcaatagtacgagtgcc
aatttcagaagttttaattatgctacacaatccgcaagaagtcctggctccactattaag
ccattagcagtttacagtcccgcagttgatgcaggttggtctatcaataaagaattggat
aatagtacaacaacgtatggaaattataccgtgaataactatgctgggattcaatccagt
ccgactgtaccaatgtatcaggctttagcacaatccttaaatattcccgcagttgcggct
gccaatgaattggggctgaaaaaggtttttgaatatggtaaaaaatttggcctgaatatg
gataaagtgagtcagacccttggggtagctcttggtagtggcgtaacaactaatccactg
caaatggcacaagcttattctacttttgcaaataatggggttatgaatgatgcgcatttg
attaccaaaattgaaaatgctagtgggcaagtcgttaaaactcataaatccacctcgact
cgagtactcaaccgctcaacaacagaaaaaatgacgagtatgatgctgggaacatttacc
aatggtactggtgtgtatgcagcaccttatggctatactatggctggaaagacgggaacg
acagaaactaactttaatccagatttatcaggagaccaatgggttattggttacacgcca
gatgtggttatcagtcagtggttaggttttccaaagacagatgaaaatcattatctgaca
ggcacaagtgccaatgaagcttcagctattttccgaagtgtggcaaatagtatcttaccg
tatacaaggggtacgaagttcggtgatgaaaatgcctatgcaaaaaatggtattgcaccg
gttgatacgagtggtacaaataacactacgaatcaaagtgacaatcgttcagatgtcttg
aaagatgtgcaggataaagctaagaacttggttgaccaagctaaaaaagcaattgatgat
gctaaaattcctgaaaaagcgaaaaatctttgggatacagtcaagagttggttccaatag

DBGET integrated database retrieval system