KEGG   Streptococcus constellatus subsp. pharyngis C232: SCRE_0637Help
Entry
SCRE_0637         CDS       T02833                                 

Gene name
glgB
Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scon  Streptococcus constellatus subsp. pharyngis C232
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scon00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SCRE_0637 (glgB)
Enzymes [BR:scon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SCRE_0637 (glgB)
Exosome [BR:scon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCRE_0637 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644643..646553
Genome map
AA seq 636 aa AA seqDB search
MDRQEALRTFTTGENFHLQHYLGVHQDEVDGQSGYTFRVWAPNAQSVHLIGDFTDWYENQ
IPMTRNEGGVWEVFTDLPKEGDIYKYNIRRSSGQEILKIDPLAIYFEKRPGTGAVVRTIP
EKKWKDGLWLARRKRWGFFSRPVNIYEVHAGSWKQNEDGSSYSFAQLKEELIPYLVKMNY
THVEFMPLMAHPLGLSWGYQLMGYFALEHTYGTPEEFRDFVEECHVNNIGVIVDWVPGHF
TINDDALAYYDGTPTFEYQDHDRAHNYGWGALNFDLGKNEVQSFLISSIKFWIDFYHLDG
IRVDAVSNMLYLDYDSGQWQPNIDGGNRNYEGYYFLQRLNTVIKLAHPDVMMIAEESTSD
TKITGMIEMGGLGFDYKWNMGWMNDILRFYEEDPIYRKYDFNLVTFSFMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLYTYQICHPGKKLLFMGSEWGQFLEWKCEES
LEWRDLADDMNAKMQHFTSRLNQLYKENRVLWENDLNWDGLEIIDADNTDQSVLSFIRKN
DKGDMLICVFNMAPVERKDFTIGVPVTAIYEEIWNTELEEWGGVWKEYNQTVQSQEGLWK
DYPQTLTFTLPALGASIWKIKRRVKSANGSKKSKKE
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggatagacaagaagcattgagaacttttaccacaggtgaaaatttccatttacaacac
tatttgggggttcatcaagatgaagttgatggacaaagcggctatacatttcgtgtatgg
gcgccaaatgctcaaagtgtgcatttgattggagactttactgactggtatgaaaatcag
attcctatgacacgcaatgaaggtggtgtttgggaagtattcacggatttgccaaaggaa
ggagatatttacaaatacaatattagacgaagcagtggtcaagaaattttaaaaattgat
cctttagctatctattttgaaaaacgtcctggtacaggtgcagttgttcggacaattcct
gaaaagaaatggaaagatggcttgtggttagctcgcagaaaacgttggggatttttctca
cgacctgtgaatatttacgaagttcatgcaggttcttggaagcaaaatgaagatggcagt
tcctactcatttgctcaattaaaagaagaactgattccttatctggttaaaatgaattat
actcatgtggaattcatgccactaatggcgcatccacttggactgagctggggttatcag
ctgatgggatattttgcacttgagcatacgtatggaactcctgaagagtttcgtgatttt
gtagaagaatgtcatgtgaataatattggagttatcgtagactgggtgccgggacatttt
actatcaatgatgatgccttggcttattatgacggtacacctacatttgagtatcaagat
catgaccgtgcccacaattatggctggggggctcttaactttgatttaggaaagaatgaa
gtacagtctttcttgatttctagtattaagttttggattgatttttatcacttagacgga
atccgtgtagacgcggttagcaacatgctctatctggattacgatagtggtcaatggcaa
ccaaatattgatgggggtaatcgaaattatgaaggttattacttccttcaacgattgaat
acggttatcaagcttgcccacccagatgtcatgatgattgcagaagaaagtacgagtgat
acaaagattacggggatgatagaaatgggtggtcttggatttgactacaagtggaacatg
ggctggatgaatgacattctgcgtttctacgaagaagatccgatttaccgcaagtatgat
tttaatctagtaacctttagtttcatgtacgctttttctgaaaacttcttgttgccattt
tctcatgacgaagtggtacatggtaagaagagtctcatgcataagatgtggggagatcgc
tataatcaatttgctggtctgcgaaatctctatacttatcaaatatgtcacccagggaag
aaattactattcatgggcagcgaatggggacaattcttagaatggaaatgcgaagaatct
ttagaatggcgtgatttggcagatgatatgaacgctaagatgcaacatttcacttctcga
ctcaatcagctttataaagaaaatcgtgttttatgggaaaacgacttgaattgggatggc
ttagaaattattgatgcggataatacagatcaaagtgtactttcctttattcggaaaaat
gacaagggagatatgctaatttgcgtctttaatatggctccggtagagcgcaaagacttt
accattggtgttccggtgacagccatatatgaagaaatttggaatactgaattagaagaa
tggggaggtgtatggaaagagtataatcaaacagttcagtctcaagaaggcttgtggaag
gattatcctcagacgttgacctttactttgccagcattaggggcaagtatttggaaaatt
aaacgtcgtgtgaaatcagcaaatggaagtaagaagtccaaaaaggagtaa

DBGET integrated database retrieval system