KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_0089Help
Entry
SCR2_0089         CDS       T02834                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase (EC:1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scos00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCR2_0089 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCR2_0089 (adhE)
   00620 Pyruvate metabolism
    SCR2_0089 (adhE)
   00650 Butanoate metabolism
    SCR2_0089 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SCR2_0089 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCR2_0089 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCR2_0089 (adhE)
   00626 Naphthalene degradation
    SCR2_0089 (adhE)
Enzymes [BR:scos01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCR2_0089 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCR2_0089 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73190..75841
Genome map
AA seq 883 aa AA seqDB search
MADKKTLTPEEKKLAAEKHVDELVQKGLIALEEMRKLNQEQVDYIVAKASVAALDAHGIL
AEHAVKETGRGVFEDKATKNLFACEHVVNNMRGVKTVGVIEDDPITGLTKIAEPVGVICG
VTPTTNPTSTAIFKSLISLKTRNPIVFAFHPSAQESSVHAAQIVCDAAIAAGAPENCVQW
ITQPSMEATTALMNHEGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVEEFKSYHTYFVNKKEKALLEEFCFGA
KANSKNCAGAKLNPNIVGKSAVWIAEQAGFKVPEGTNILAAECAEVGPNEPLTREKLSPV
IAVLKAEDTEDGLTKARQMVEFNGLGHSAAIHTKDEALAKRFGTEIKAMRIIWNSPSTFG
GIGDVYNAFIPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGKRRNNMQWFKVPSKIYFER
NSIQYLQTCEDIERVMIVTDKSIEKLGFVQRVIDQLNLRKNKVTIQVFSDVEPDPDITTI
RRGTEEMRAFEPDTIIALGGGSPMDAAKGMWMFYEQPEVDFSDLVQKFMDIRKRAFKFPS
LGKKAKYIGIPTTSGTGSEVTPFAVISDKANNCKYPLADYALTPTIAIVDPALVESVPAF
IAADTGMDVLTHATEAYTSNFANDYTDGIALQTIKLVFKYLEKSVKTADPEAREKMHNAS
TMAGMAFANAFLGMSHSMAHKIGGVHHTIHGRTNAILLPYVIRYNGTRPSKTTTWPKYNY
WKADEKFQDIARMLGLPCSTPEEAVEAYAKAVYDLGVAVGIKMNFKDQGIDEKVWNESLH
EIALLAYEDQCSPANPRLPMVADMEEIMADAYYGYAERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaacattaactcccgaagaaaaaaagttagctgctgaaaagcatgtc
gacgaacttgttcaaaaagggctaattgctctagaagaaatgagaaaattaaatcaagaa
caagtagactacattgttgcaaaagcttcagttgctgctcttgatgcgcacggtatctta
gctgagcatgctgttaaagaaacgggtcgcggtgtctttgaagacaaagcaacgaagaac
ctctttgcctgtgagcatgttgttaacaatatgcgtggtgttaaaactgttggtgttatt
gaagatgatccaattacaggtttgactaaaattgctgaaccagttggtgttatctgtggt
gtaactcctacaaccaacccaacttcaactgcgatttttaaatctttgatttcattgaaa
acacgcaatccaattgtgtttgctttccacccatctgctcaagaatcttctgttcatgca
gcacaaatcgtttgtgatgcagcgattgcagcaggagcacctgaaaactgcgtgcaatgg
attactcaaccatctatggaagctacaacagctttgatgaatcatgaaggtattgcaacc
attcttgcgactggtgggaatgctatggtaaaagctgcttattcatgtggaaaaccagcc
cttggagttggtgctggaaatgtgccagcttatgttgaaaaatcagctaatatccgccaa
gcagcacatgacatcgttatgtctaaatcttttgataacggaatggtttgcgcgtctgaa
caagcagttatcattgataaagaaatctatgatgaatttgtagaagaattcaaatcatat
catacttattttgtaaacaaaaaagaaaaagcccttctggaagaattctgctttggtgct
aaagcgaacagcaaaaactgtgctggtgctaagctaaatccaaatatcgttggtaaatca
gctgtttggattgcagaacaagctgggttcaaagtaccagaaggtacaaacatcctggct
gcagaatgtgcagaagtaggtccaaatgagccattgactcgcgaaaaactttcaccagtt
attgctgtcttgaaagctgaagatacagaagacggtcttacaaaagctcgtcaaatggtt
gaatttaacggacttggtcactcagctgctatccatacaaaagatgaagctcttgctaaa
cgctttggtactgaaatcaaagctatgcggattatctggaactctccatctactttcggt
ggtattggggatgtatataatgccttcattccatccttgacacttggatgtggttcatac
ggacgtaactcagttggtgataacgttagcgctattaacctcttaaacatcaagaaagta
gggaaacgtagaaataatatgcaatggtttaaagttccttcaaaaatttacttcgagcgc
aactctatccaataccttcaaacatgtgaagatattgaacgcgttatgattgttaccgat
aagtccatcgaaaaacttggctttgtgcaacgtgtaattgaccagttgaatctccgtaag
aataaagtgacaatccaagtcttctcagatgtagagccagatccagatattacaactatc
cgtcgtggtacagaagaaatgcgtgcctttgaaccagatacaatcatcgcactcggtggt
ggttctccaatggacgctgctaagggtatgtggatgttctatgaacaaccagaagttgac
ttcagcgatcttgttcaaaaattcatggatattcgtaaacgtgccttcaaattcccatca
cttggtaagaaagcgaaatacattggtatcccaacaacatctggtacaggttcagaagta
acaccgtttgctgttatctctgataaagcaaacaattgtaaatacccacttgctgactat
gctttgacgccaaccattgcgattgttgacccagctttggtagaatctgttccagcattt
atcgcagcagatacaggtatggatgttctaactcacgctacagaagcctatacttcaaac
tttgctaatgactatacagatggtattgcccttcaaactattaagttggtctttaaatac
ttggaaaaatctgtaaaaacagctgacccagaagctcgagaaaagatgcacaatgcttct
acaatggctggtatggcatttgctaatgccttccttggaatgagccactcaatggctcac
aagattggtggagttcaccatacaattcacggacgcaccaatgcaatcttgcttccatat
gttatccgttacaatggaactcgtccatctaagactacaacatggcctaaatacaattac
tggaaagctgatgaaaaattccaagacattgctcgtatgcttggtttgccatgctcaact
ccggaagaagcagttgaagcttatgcaaaagctgtgtatgatcttggtgtggcagtcggc
atcaagatgaacttcaaagatcaaggaattgatgaaaaagtttggaatgaaagtctgcat
gaaattgcccttttggcttatgaagaccaatgttcaccagctaatccacgattgccaatg
gtagctgatatggaagaaatcatggctgacgcttactatggctatgcagaacgtccagga
cgtcgtaaatag

DBGET integrated database retrieval system