KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_0781Help
Entry
SCR2_0781         CDS       T02834                                 

Gene name
mutM
Definition
(GenBank) formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:scos00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SCR2_0781 (mutM)
Enzymes [BR:scos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SCR2_0781 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SCR2_0781 (mutM)
DNA repair and recombination proteins [BR:scos03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SCR2_0781 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
794521..795345
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVRRGLERLVKGKEIEKVDVRYTKMIGTGVDTFVLDLPRQSIDAVERRGKYL
IFYLTNWVLISHLRMEGKYLFYPEEAQLTKHSHVIFHFTDGSNLVYQDVRKFGTMELLKK
EQLDSYFLSKKLGPEPTELDFHLLPFATALRKSKKLIKPYLLDQTLVAGLGNIYVDEVLW
RAQIHPERAAQSLNRAEMKHLREQIIAVLQLGIEKGGSTIRTYRNALGEDGTMQDFLQVY
GKTGQSCTRCGHEIEKIKLAGRGTHLCPHCQKMR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaagtagaaacggtacgccgtggtttggagcggctggttaaagga
aaagagattgaaaaggtagatgtccgttataccaagatgattgggacaggggtagatact
tttgtcttagatttaccgagacaaagtattgatgctgttgagcgtcggggcaaatatctg
attttttatttgacaaattgggtgctgatttcgcatttgcgcatggaaggaaagtatctt
ttctaccctgaagaggcccaattgactaagcattctcatgtaatttttcatttcacagat
ggcagcaacctcgtttatcaggatgttcggaaatttggtacaatggaattgttgaaaaaa
gaacagctggatagctattttctctctaaaaagttaggaccagaaccgaccgaattagac
tttcatttactaccatttgcaacagctctaagaaagtctaagaaactgattaaaccttac
ctattggatcaaaccttagtagcgggtcttggtaatatctatgtggatgaagttttatgg
cgggcacagattcacccagaaagagcagcccaaagcctgaatagagcagaaatgaagcat
ctgcgagaacaaattattgcggtcttgcagttaggaattgaaaagggaggctcgaccatt
cgcacttatcgcaatgctttaggagaagacggcacaatgcaagatttcttgcaagtctat
gggaaaacagggcaatcttgcactagatgtggtcatgaaattgaaaaaatcaaactagct
ggtcgcggaactcacctttgtccacattgtcaaaaaatgaggtag

DBGET integrated database retrieval system