KEGG   Streptococcus constellatus subsp. pharyngis C818: SCR2_1814Help
Entry
SCR2_1814         CDS       T02834                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
scos  Streptococcus constellatus subsp. pharyngis C818
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:scos00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850415..1851938)
Genome map
AA seq 507 aa AA seqDB search
MKERQSGVLMHISSLPGKYGIGSFGKSAYDFVDFLVRTKQRYWQILPLGTTSYGDSPYQS
FSAFAGNTHFIDFDRLIEEGLLVQSDLEGLDFGQDPRKVDYAKVFNNRRPVLEKAVKRFL
ECGDLAAYEKFVADNSSWLEVFVEYMAIKEYFDLKAWTEWPDAALRRREAASLAHYREKL
ADRLTYHRVTQYLFFKQWLELKAYANEHYIEIVGDMPIYVAADSCDVWAQPHFFKTDELG
QPICVAGCPPDEFSATGQLWGNPIYDWKAMDKDGYSWWIKRLRESFKIYDVVRIDHFRGF
ESYWEIPASSDTAAPGKWVKGPDYALFKAVKEELGDLNIIAEDLGFMTDEVIALREKTGF
PGMKVTQFAFNPDSESIDSPHLAPNNSVMYTGTHDNNTVLGWYRDEIDDATREYMAQYTN
RKEYETVPHAMLRTIFSSVSFMAIATMQDLLELDGSARMNYPSTIGGNWSWRMTADDLDP
VIEAELYSLTKTYRRVNKELLNHENEL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcgtcaaagtggtgttctcatgcatatttcttctctgccaggaaaatatgga
attggttcatttgggaaaagtgcttacgattttgtcgattttctggtgagaactaagcaa
cgttactggcaaatattgccactaggaacaactagttatggagattctccatatcaatct
ttctctgcatttgcgggaaatacacattttattgattttgatcgattgattgaagaagga
ttgcttgtgcaaagtgatcttgaagggttagactttggtcaggatccaagaaaagtagat
tatgcgaaagtgtttaacaatcgcagacctgttttggaaaaagctgtgaaacgtttctta
gaatgtggagatttggcagcctatgaaaaatttgtggctgacaattcatcatggcttgaa
gtatttgttgaatacatggcgattaaagaatattttgacttgaaagcttggactgaatgg
ccagatgcggctcttcggcgtcgtgaagcagctagtttagctcattatcgtgaaaaatta
gctgacagattgacttatcatcgtgtaacgcagtatcttttctttaaacaatggttagaa
ttaaaagcgtatgccaatgaacattacattgaaattgtcggcgatatgccaatctatgta
gcagctgatagctgtgatgtttgggcacaaccacacttctttaaaacagatgagctaggg
cagcctatatgcgtagcgggatgcccaccagatgaattctctgcaactggccaactctgg
gggaacccaatttatgactggaaagcaatggataaagatggttatagttggtggattaaa
cgcctacgtgaaagcttcaagatttatgatgtagtgcgtattgatcatttccgtggattt
gaatcttactgggaaatccctgctagttccgatacagcagctcctggtaaatgggttaag
ggacctgactatgctttgtttaaagcagtgaaagaagagttaggtgatctgaatattatt
gctgaagacttgggctttatgaccgatgaagtgattgctttacgtgaaaagacaggcttc
cctggtatgaaagtgactcaatttgcttttaatccagacagcgaaagtattgatagtcca
catcttgcgcctaataattctgtgatgtacacagggacacatgataacaatactgttctt
ggttggtatcgtgatgaaatcgatgatgctacacgtgaatatatggctcaatataccaat
cgtaaggaatatgaaacagtacctcatgcaatgttacggactatcttttcttctgtcagc
tttatggcaattgcaaccatgcaagatttacttgaattagacggttcagctcgcatgaac
tatccatcaactattggtggaaattggtcctggcgtatgacagcagatgatttggatcct
gtgattgaagcagagttatatagcttgacgaaaacatatcgtcgtgtaaataaagaatta
ttaaatcatgaaaatgaactctag

DBGET integrated database retrieval system