KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10050Help
Entry
HMPREF0833_10050  CDS       T01545                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0833_10050 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_10050 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0833_10050 (trpB)
Enzymes [BR:scp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0833_10050 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
44694..45881
Genome map
AA seq 395 aa AA seqDB search
MTETKGYFGQFGGSFVPEPIQNLLNQLEETFEQYKNDPEFIAEYKHYLKDYSGRETPLYF
AESLTEHLGGAKIYLKREDLNHLGSHKLNNVLGQILLAKRMGKTRVIAETGAGQHGVATA
AAAAKFGMACDVYMGAEDVERQRLNVFRMEMMGATVHAVETGTKTLKDAVDAAFGAWMAD
LDAFYVLGSAVGPHPYPTIVHEFQKVISEESKRQILEKEGRLPDYVIACVGGGSNAIGAF
SEYVAEEEVGLIGVEAAGHGLDTDQHAATMTKGTIGVVDGMKTYAVFGEDGKVAPVYSIS
AGLDYPGVGPEHAFFKDSGRVEYVAATDDEAVEALLLLSKTEGILPAIESSHAIAEAVKR
APQLDKDKIIIINVSGRGDKDVAAIADYLEAKAAK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaacaaaaggctatttcggacaatttggtggatctttcgtaccagaaccgatt
caaaacttgctcaatcaattagaggaaacctttgaacagtataaaaatgacccagaattt
atcgcagaatacaaacattatttgaaagattattctggacgggaaacaccgctttacttt
gcggaaagtttgacagagcatttaggtggggcaaaaatttatttgaagcgcgaagacttg
aatcacctaggttctcataaattaaataacgtcttggggcaaatcctcttggccaaacgc
atgggcaaaacgcgcgtgattgctgaaacaggagcaggtcaacacggtgtagctacagca
gctgcggcagctaagtttggcatggcctgtgatgtctacatgggggcagaagacgtggaa
cgccaacgcttgaatgtcttccgcatggaaatgatgggggcaaccgtccatgcggttgaa
accggtactaagaccttgaaagacgccgtggatgctgcgtttggagcatggatggcagat
ctggatgccttttacgttttgggttctgctgttggccctcacccttacccaaccattgtg
catgaattccaaaaggtgatcagtgaagaatctaaacgtcaaatcttggaaaaagaaggt
cgtttgccggattatgtgattgcctgtgtcggtggtggctctaatgccatcggtgccttt
tctgaatatgtcgcagaagaggaagtcggcttgattggggtagaagcagctggtcatggc
ttggacaccgatcaacacgcagcgaccatgaccaaagggactatcggtgtggttgatggt
atgaagacctatgcagtctttggcgaagatggaaaagtagcgccagtttactcgatctct
gctggtttggactacccaggggttggcccagagcatgctttctttaaagattctggtcgt
gtagaatatgtagcagcgacagatgatgaagcagtagaagctcttcttcttctcagtaag
acagaagggatcctcccagccattgaaagctcacacgcgattgcagaagcggttaaacgt
gctccacaattagataaagacaagatcatcatcatcaatgtttccggacgtggggacaag
gatgtagctgccatcgctgattatctagaagcgaaggctgcaaaataa

DBGET integrated database retrieval system