KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10093Help
Entry
HMPREF0833_10093  CDS       T01545                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0833_10093 (gpmA)
   01230 Biosynthesis of amino acids
    HMPREF0833_10093 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10093 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0833_10093 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_10093 (gpmA)
Enzymes [BR:scp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0833_10093 (gpmA)
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0833_10093 (gpmA)
  Exosomal proteins of melanoma cells
   HMPREF0833_10093 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86193..86885
Genome map
AA seq 230 aa AA seqDB search
MVKLVFARHGESEWNKANLFTGWADVDLSEKGTQQAIDAGKLIKEAGIEFDQAYTSVLKR
AIKTTNLALEASDQLWVPVEKSWRLNERHYGGLTGKNKAEAAEQFGDEQVHIWRRSYDVL
PPAMDRDDEHSAHTDRRYASLDDSVIPDAENLKVTLERALPFWEDKIAPALKDGKNVFVG
AHGNSIRALVKHIKQLSDDEIMDVEIPNFPPLVFEFDEKLNVVKEYYLGK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaattggtttttgctcgccacggtgagtctgaatggaacaaagctaaccttttc
actggttgggctgatgttgatttgtctgaaaaaggtacacaacaagcgatcgacgctggt
aaattgatcaaagaagctggtatcgaatttgaccaagcttacacttcagtattgaaacgt
gcgatcaaaactactaacttggctcttgaagcttctgaccaattgtgggttccagttgaa
aaatcatggcgtttgaacgaacgtcactacggtggtttgactggtaaaaataaagcagaa
gctgctgaacaatttggtgatgaacaagttcacatctggcgtcgttcttacgatgtattg
cctcctgcaatggaccgtgatgatgaacactcagcacacactgaccgtcgttacgcttca
cttgacgattcagtgattccagatgctgaaaacttgaaagtgactttggaacgtgccctt
ccattctgggaagataaaatcgctccagctcttaaagacggtaaaaacgtattcgtagga
gcacacggtaactcaatccgtgcccttgtaaaacacatcaaacaattgtcagacgacgaa
atcatggatgtggaaatccctaacttcccaccattggtattcgaatttgacgaaaaattg
aacgttgtaaaagaatactatcttggaaaataa

DBGET integrated database retrieval system