KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10203Help
Entry
HMPREF0833_10203  CDS       T01545                                 

Gene name
glgB
Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0833_10203 (glgB)
Enzymes [BR:scp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HMPREF0833_10203 (glgB)
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0833_10203 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207820..209727
Genome map
AA seq 635 aa AA seqDB search
MDRSTDLWTFGRGDNFRLQEYLGAHKEFEGDQEGYTFRVWAPNAQAVDLIGDFTDWEARR
IPMVRNEGGVWEVFCPDAKEGDIYKYLVTRQNGHQVQKIDPLALWMEKRPNTGSIIKTIP
EKNWKDGLWRARRKKLGFKERPVNIYEVHAGSWKRNEDHSSYTFKQLKEELIPYLVEMNY
THVEFMPVMAHPLGLSWGYQLMGYFALEQTYGSPEEFQDFVEECHLNNIGVIVDWVPGHF
IINDDALAYYDGTPTFEYQDEHRAHNYGWGALNFDLGKNQVQSFLISSLKFWIDTYHLDG
IRVDAVSNMLYLDYDSGPWTPNIDGGNLNYEGVHFLRRLNAIIKNEHPDVMMIAEESSAG
QKVTGPEEEGGLGFDYKWNMGWMNDILRFYEEDPVYRKFDFNLVTFSYMYAFSENFLLPF
SHDEVVHGKKSLMHKMWGDRYNQFAGLRNLLTYQICHPGKKLLFMGSEFGQFLEWKSEEQ
LEWGNLEDEMNAKMRRFTSQLNHFYKEHKELWEIDDSFDGLEIIDADNRDQSVLSMVRKN
RKGDLLVCVFNMAPVERKDFTIGVPVSAVYEEIWNTELEEWGGVWKEHNPTVQSQEGLWK
DYEQTLTFTLPALGASIWKVKRKVRKTKSKTSDKK
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagcacagacttatggacgtttggaagaggggataatttccgtcttcaagag
tacttaggagctcacaaagagttcgaaggagatcaagaaggttacaccttccgtgtatgg
gctccaaatgcacaggctgttgatctgattggtgatttcactgattgggaagcccgtaga
attccaatggttcgtaatgaaggaggcgtctgggaagtcttctgtcccgatgcaaaagag
ggagatatatacaagtacttggtgacgcgacaaaatggtcatcaggtacaaaaaattgat
cctctagcgttatggatggaaaagagacccaatacaggatctattattaagaccatccca
gagaaaaactggaaagatggtctttggagggcacgccgtaaaaagcttggttttaaggaa
cgacctgttaatatctatgaggtgcacgcaggatcgtggaaacgaaatgaagatcacagt
tcctatacctttaaacaactaaaagaagaactgattccttatctagttgagatgaactac
actcacgtggaatttatgccagttatggcccacccattgggactgagctggggatatcag
ctcatgggttattttgcactcgaacagacttatggtagtccagaagagtttcaagacttc
gtggaagaatgtcatctcaataatatcggtgttatcgtggattgggtacctggtcatttc
attatcaatgatgatgccttggcttattatgatggaacaccaacttttgagtatcaggat
gaacatcgggcccataactatggttggggagctttgaacttcgatttaggaaaaaatcaa
gtacaatcattcttgatttctagtttgaagttttggattgacacctatcatttagatgga
attcgggttgatgccgtgagcaatatgctctatcttgattacgatagcggtccatggaca
ccaaatattgatgggggaaacctcaactatgaaggggttcatttcctcagacgtttgaat
gcgattatcaagaacgaacacccagatgttatgatgattgcagaagaaagttctgctggt
caaaaggtcacaggccctgaagaagaaggtggtcttggttttgactataaatggaatatg
ggttggatgaatgatattctccgattctatgaggaagacccggtctacaggaaatttgac
tttaatctggtaacctttagttatatgtatgcattttctgaaaatttccttcttccgttt
tcacatgatgaagtagtgcatggcaagaagagtttgatgcacaagatgtggggagatcgt
tacaatcaatttgctggactccgtaaccttttgacctatcagatttgccatccaggaaaa
aaattactctttatgggttcggaatttggtcaatttttggaatggaagtcagaagagcaa
ctggaatggggcaatctagaggatgaaatgaacgccaagatgcgtcgtttcacttctcag
ctcaatcatttctacaaggaacacaaggaattgtgggagattgatgatagctttgatggc
ttagagattattgatgcagataaccgggatcagagcgtcttgtctatggtccggaaaaat
cgtaagggcgatcttttggtgtgcgttttcaatatggcaccagtagaacgcaaggacttt
acgattggtgtgcctgtatcagcggtctatgaagaaatttggaatacagaattagaagaa
tggggaggtgtctggaaagagcacaatccgacagttcagtctcaagagggactgtggaag
gattatgaacaaaccttgacctttactttgccggctttaggtgctagcatttggaaggtg
aaacgcaaggtgcgtaagacaaaatctaaaacatcagataagaaatga

DBGET integrated database retrieval system