KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10249Help
Entry
HMPREF0833_10249  CDS       T01545                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0833_10249 (pfkA)
   01230 Biosynthesis of amino acids
    HMPREF0833_10249 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10249 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0833_10249 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0833_10249 (pfkA)
   00052 Galactose metabolism
    HMPREF0833_10249 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0833_10249 (pfkA)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0833_10249 (pfkA)
Protein phosphatases and associated proteins [BR:scp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0833_10249 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
259184..260197
Genome map
AA seq 337 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGKIQPLDRSSVGDI
ISRGGTFLHSARYPEFAQREGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTELGFPAV
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHHRTFVIEVMGRNAGDIALWA
GIASGADEIIIPEEGFKIEDVVESIKEGYAKGRTHNIIILAEGVMSADEFGKALKAAGDE
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKQGIGGVAVGIRNEKMVENPILGK
AEEGALFSLTEDGKIVVNNPHKADLGLAELNRSLSSI
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggagatgcccctggtatgaatgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagttttcggtatctatgatgga
tatgcgggaatggttgctggtaaaattcagccccttgatagatcatctgttggagatatt
atttcccgtggtggtactttccttcattcagcacgttaccctgaattcgcacaacgcgaa
ggtcaattaaaagggatcgagcaattgaagaaacacgggatcgaaggtgttgtcgttatt
ggtggagatggttcttaccatggtgcgatgcgcttgactgaacttggattcccagctgtt
ggtcttcctggtacgatcgacaacgatattgtcggaactgattttacaattggttttgat
actgcagtcacaactgcaatggacgcgatcgataagatccgtgatacttcatctagtcac
caccgtaccttcgttattgaagtgatgggacgtaacgctggagatatcgctctttgggca
gggattgcatctggtgcagatgaaatcatcattcctgaagaaggattcaagatcgaagat
gttgttgagagcatcaaagaaggttacgcaaaaggccgtacccacaacattatcatttta
gctgaaggcgtgatgtctgcagatgaattcggtaaagccttgaaagcggctggtgatgaa
agtgaccttcgtgtgactgaacttggccacatccaacgtggtggttcacctactgcgcgt
gaccgtgttcttgcttcacgtatgggagcacacgctgttaaattgctgaaacaaggaatc
ggtggtgtagccgttggtatccgtaatgaaaaaatggttgaaaacccaatccttggtaaa
gcagaagaaggagccctctttagcttgacagaagatggtaagattgtggtaaacaatcca
cataaagctgatcttggtcttgccgagttgaaccgtagcttgtcttcaatctaa

DBGET integrated database retrieval system