KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10311Help
Entry
HMPREF0833_10311  CDS       T01545                                 

Gene name
murA2
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_10311 (murA2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    HMPREF0833_10311 (murA2)
Enzymes [BR:scp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     HMPREF0833_10311 (murA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
322914..324197
Genome map
AA seq 427 aa AA seqDB search
MKELIIIKMKKIVINGGRPLKGEVTISGAKNSVVALIPATILADDIVTLDGVPDISDVAS
LIEIMTIMGAKIERKEDSLIIDPRGVKDMPMPFGKINSLRASYYFYGSLLGRYGQATVGL
PGGCDLGPRPIDLHLKAFEAMGAAMTMDGSSMKLATDGKPLQGANIYMDTVSVGATINTI
LAAVKAKGRTVIENAAREPEIIDVVTLLNNMGAHIRGAGTDIIIIDGVPHLHGTRHQVIP
DRIEAGTYIALAAAIGEGIQINNVLYEHLESYIAKLEEMGVCMTISEDSIFVEKQTGLKA
IQIKTSPYPGFATDLQQPITPLLLTAAGRGRIVDTIYEKRVNHVPELAKMGATILTLNDH
IIYEGPNQLTGSSVKATDLRAGAALVIAGLMASGTTEITNVEYILRGYSDIIHKLTQLGA
DIQLIEE
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagctaataattattaagatgaaaaaaattgtaataaatggaggtcgccctcta
aaaggagaggtgaccattagtggtgcaaaaaatagtgtagtggccctgattcctgcaacc
attctggcggacgatatcgtgaccctcgatggggtaccggatatctcagatgttgcaagt
ctgattgaaatcatgaccatcatgggcgctaagatcgaacgcaaagaagacagtttgatc
attgatccacgtggggtgaaggatatgcccatgccatttgggaaaatcaatagcttacga
gcttcctattatttctatggcagtttgttagggcgctatggtcaagcaactgttggacta
cctggaggatgcgatctcggcccacgtccaattgatttgcatttgaaggcctttgaagcg
atgggagccgctatgactatggatggctctagtatgaaacttgcgacagatggcaagcct
cttcaaggagctaacatctatatggatactgttagtgtcggtgcaacgatcaatacgatt
ttggcagcagtcaaagctaaaggtcggacagtgatcgaaaatgctgcgcgggaacctgaa
attatcgatgtggtgaccttgctcaacaacatgggagctcatattcgtggagcagggaca
gatattattatcattgatggtgttccgcatttgcatgggactagacatcaagtaattccg
gatcgcatcgaggcaggaacctatattgctcttgcagctgctattggggaaggtatccag
atcaataatgtcttgtacgagcatttagagagctatattgccaaattagaggaaatgggt
gtgtgcatgaccatttctgaagatagtatctttgtagaaaagcaaacaggcttgaaggcc
atccagatcaaaacgtctccttatccaggttttgcgactgatttgcaacaaccgatcaca
cctttgctcttaacggctgcaggacgtgggcgaatcgttgatacgatttatgaaaaacgg
gttaaccatgtgccagaattggctaaaatgggggctactatcttgactttgaacgaccac
attatctatgaagggccaaatcaattgacgggatccagtgtgaaagcgacagatcttcga
gctggtgcggctttagtgatcgcaggtctcatggcttctggaacaacagaaattacaaat
gtggaatacatccttcgcgggtattcagatattattcataaattgacccaacttggagca
gatatccagttgatagaagagtag

DBGET integrated database retrieval system