KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10343Help
Entry
HMPREF0833_10343  CDS       T01545                                 

Gene name
scrP
Definition
(RefSeq) sucrose phosphorylase (EC:2.4.1.7)
  KO
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0833_10343 (scrP)
Enzymes [BR:scp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HMPREF0833_10343 (scrP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356541..357866
Genome map
AA seq 441 aa AA seqDB search
MKDVVGGVHILPFFPSSGDRGFAPMDYSKVDEAFGDWSDIEALSQDYYLMFDFMINHISA
KSPYFLDFLEKKDESAYADLFIRYKNFWPNGESTQEDVDLIYKRKPRAPYRIAKFADGSE
EKVWCTFDEQQIDLDVTTETTRRFIQENLEQLADHGASIIRLDAFAYANKKIGTNCFFVE
PDIWETLHFPRQLLAPKRVEILPEIHEHYTIQQKIAEQDYYVYDFALPMLVLHALYSGNV
NRLVHWMEICHRKQFTTLDTHDGIGVAHVKDLLTDEETEATREALYAQGANVKKIYSSEA
YNNLDIYKINCTYYSALGNDDQAYLLARVLQCFAPGSPQIYYVGLLAGENDIELLESTKE
GRNINRHYYDLEEIEREVQRPVVQSLFNLLKFRNTSAAFDGEFAVDMEDSNTIHISWTNT
DANTVAELRTNLKDKSFEITE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatgtggtcggtggtgtccacattcttcccttctttccatcgtcaggcgaccgc
gggtttgcacccatggactatagcaaggttgatgaggcttttggagattggagcgatatt
gaggcactcagtcaagactactacctcatgtttgatttcatgattaaccatatctcagcc
aagtcgccttatttccttgatttcctagaaaagaaagatgagtctgcctatgcggatttg
tttatccgctacaaaaacttttggccaaacggtgagtcgactcaggaagatgtagacctg
atttacaaacggaagccacgtgctccctatcgcattgccaagtttgctgatggtagtgag
gaaaaagtttggtgtacctttgatgagcaacagatcgacctcgatgtgacaacagaaaca
actcgtcgctttattcaggaaaatctggaacagctagcggaccacggagcttccattatt
cgcttggacgcctttgcctacgccaataagaaaatcggcaccaactgtttctttgttgag
ccagatatttgggaaacgcttcattttccgcgtcagctattggcaccaaaaagagtggaa
attcttccagaaattcatgaacattacaccattcagcaaaaaatcgctgagcaagactac
tatgtctatgactttgcccttccgatgctggttcttcatgctctttattcaggtaatgtc
aaccgtcttgttcactggatggaaatctgccatcggaagcaatttacaaccttggacacg
cacgatggtatcggagtggcccatgtcaaggacttgctgacagatgaggaaacagaggcg
acaagagaagccctctatgcccaaggagcaaatgtcaaaaagatttacagctcagaggcc
tacaacaatttggatatttataagataaattgtacctactattcagctttaggaaatgat
gaccaagcctatctcttggcacgtgtgcttcaatgttttgcaccaggtagtccgcagatt
tactacgttggcttgttggcaggagaaaatgatatcgaattgctcgaatcaaccaaagaa
ggccgcaacatcaaccgtcactattatgatttggaagaaattgagcgagaagttcaacgc
ccagttgtgcagtccttgttcaatctgctcaaattccgtaataccagcgcagcatttgat
ggagagtttgctgttgacatggaagactctaatactatccacatcagctggaccaatacc
gatgccaatacagtggcagaattaagaactaatctaaaagataaatcatttgaaattaca
gagtaa

DBGET integrated database retrieval system