KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10381Help
Entry
HMPREF0833_10381  CDS       T01545                                 

Gene name
gplK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0833_10381 (gplK)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     HMPREF0833_10381 (gplK)
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HMPREF0833_10381 (gplK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
387200..388708
Genome map
AA seq 502 aa AA seqDB search
MSQETFIMAIDQGTTSSRAIIFNKKGEQVSSSQKEFTQIFPQAGWVEHNANEIWNSVQSV
IAEVFIESGIKPNQIEAIGITNQRETTVVWDKNTGLPIYNAIVWQSRQTAPLAEELKNQG
YVETFHQKTGLVIDAYFSATKVRWILDHVEGAQERAEKGELLFGTIDTWLVWKLTDGAAH
VTDYSNAARTMLYNIKELKWDEEILEILNIPKAMLPEVRSNSEIYGKTAPFHFYGGQVPI
AGMAGDQQAALFGQLAFEPGMVKNTYGTGSFIIMNTGEEMQLSENNLLTTIGYGINGKVY
YALEGSIFIAGSAIQWLRDGLRMIDSSPESEAYALKSQNQDEIYVVPAFTGLGAPYWNQE
ARGSVFGLTRGTTKEDFIKATLQSIAYQVRDIIDTMQVDAKTPIPVLKVDGGAAKNDYLM
QFQADILGIAIARAKNLETTALGAAFLAGLTVGYWKDLEELKSLHGAAQIFEPKMNESRK
EELYKGWKKAVKATQVFAESDD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagaaactttcatcatggcgattgaccagggaaccactagttcgcgggctatc
atttttaataaaaaaggcgagcaagttagctctagtcaaaaggaattcactcagattttt
ccgcaggctggttgggtggaacacaatgccaatgagatttggaactcggttcagtcggtg
atcgctgaggtctttattgaaagtggcatcaagcccaatcaaatcgaggcgatcggcatt
accaatcaacgggaaacgacagttgtttgggataagaacacaggccttcctatttacaat
gctattgtctggcaatcgcgacaaactgctccactggctgaagaacttaaaaaccaaggc
tatgtagaaaccttccaccaaaagacaggtttggtcatcgatgcctacttttcagcaaca
aaagttcgttggattttggaccatgttgaaggagcacaagagcgtgcagaaaaaggagaa
ttgctctttgggaccattgatacttggttggtctggaagctgacggatggagcagcccac
gtgacagactattctaatgctgctcggaccatgctttacaatatcaaggaactaaaatgg
gacgaagaaattttggaaatcctcaacattcctaaagccatgcttcctgaagtccgttca
aactctgaaatttatggcaagacagcgcctttccatttctacggtggacaagtgccgatt
gcagggatggcgggagaccagcaagctgccctctttggtcaattagcctttgaacctggg
atggtcaagaatacttacggaactggatcttttatcatcatgaatacgggtgaagagatg
cagttatcagaaaataacttgctgacgacgattggatatgggatcaatggcaaggtctac
tacgcccttgaaggatcgatctttatcgccggaagtgctattcagtggcttcgtgacggt
ctgcggatgatcgacagttcacctgaatctgaggcctatgctttgaagtcccagaaccag
gatgaaatctatgtggtccctgcctttacgggtcttggagcaccatactggaatcaagag
gcgcgtggttctgtctttggacttacccggggaacgaccaaggaagactttatcaaggca
acccttcaatccattgcttatcaagtacgcgatattatcgacaccatgcaggtagatgcc
aagactcctatccctgtcctaaaagtagacggaggagcagcgaaaaatgattatttaatg
cagtttcaggcagatattcttggaattgcaattgcccgcgcgaaaaacttggaaacaacg
gctctaggagcagccttcctagcaggtctgaccgtaggctattggaaggacttggaagaa
ttaaaatctcttcatggagcagcccaaatctttgaacccaagatgaatgaatctcgaaag
gaagagctgtacaaggggtggaagaaagcagtcaaagccactcaagtatttgcagagtct
gatgactaa

DBGET integrated database retrieval system