KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10512Help
Entry
HMPREF0833_10512  CDS       T01545                                 

Definition
(GenBank) 2-oxo acid dehydrogenase acyltransferase (catalytic domain)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00010  Glycolysis / Gluconeogenesis
scp00020  Citrate cycle (TCA cycle)
scp00620  Pyruvate metabolism
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01120  Microbial metabolism in diverse environments
scp01130  Biosynthesis of antibiotics
scp01200  Carbon metabolism
Module
scp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10512
   00020 Citrate cycle (TCA cycle)
    HMPREF0833_10512
   00620 Pyruvate metabolism
    HMPREF0833_10512
Enzymes [BR:scp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     HMPREF0833_10512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AEH55543
UniProt: F8DJ04
Position
complement(524582..525625)
Genome map
AA seq 347 aa AA seqDB search
MADDKLRATPAARKLADDLGINLYDVSGSGANGRVHKEDVETYKETNVVRISPLAKRIAL
EHNIAWQEIQGTGHRGKIMKKDVLAFLPENIENETIKSPAQIEKVEEVPDNVTPYGEIER
IPMTPMRKVIAQRMVESYLTAPTFTLNYDVDMSELLALRKKVLDPIMEATGKKVTVTDLL
SLAVVKTLMKHPYINASLTEDGKTIITHNYVNLAMAVGMDNGLMTPVVYNAEKMTLSELV
VAFKDVIGRTLDGKLAPSELQNSTFTISNLGMFGVQSFGPIINQPNSAILGVSATVEKPV
VVNGEIVIRPIMSLGLTIDHRVVDGMAGAKFMKDLKALIEDPISMLV
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgataagctaagagcgactcctgcggctagaaaattagcggatgatcttgga
atcaacctctatgatgtttctggttcaggcgcaaacggtcgtgtccacaaagaagacgtg
gaaacctataaagaaacaaatgtggttcgcatttcaccacttgcaaaacgaattgcacta
gagcataatattgcttggcaagaaatccaaggaactggtcatcgtggcaagattatgaaa
aaggacgtccttgctttccttcctgaaaatattgagaatgagaccattaaatcacctgct
caaattgagaaagtggaagaagttccagataacgtgacaccttatggagaaatcgagcgt
ataccgatgactcctatgcgtaaggttattgctcaacgtatggttgagtcatacttaact
gctccaaccttcacgcttaactacgatgtagatatgtctgaattgcttgcccttcgtaag
aaagttcttgatccaattatggaagcaacaggtaagaaggtgactgtaacagatttgctt
tctctagcagttgttaagaccttgatgaagcacccatacatcaatgcgtcattgacagaa
gatggtaaaacaattatcacccacaactacgttaatcttgcgatggcggttgggatggac
aatggcttgatgactccagttgtctacaatgctgaaaagatgaccttgtcagagttggtg
gtagccttcaaggacgttatcggacgtaccttggatggtaagcttgctccaagtgaattg
caaaactctacctttaccatcagtaacttaggaatgtttggcgttcaatcatttggaccg
attatcaaccaaccaaactctgctatcctaggggttagtgcaacggttgaaaaaccagtt
gttgtgaatggtgaaattgtcattcgtccaatcatgagcttgggcttgaccattgaccac
cgtgttgtcgatgggatggctggtgccaaattcatgaaagacttgaaagccttgattgaa
gacccgatttcaatgttggtctaa

DBGET integrated database retrieval system