KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10569Help
Entry
HMPREF0833_10569  CDS       T01545                                 

Definition
beta-N-acetylglucosaminidase/beta-glucosidase (EC:3.2.1.21 3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:scp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:scp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(588014..589660)
Genome map
AA seq 548 aa AA seqDB search
MMKLTEKPFYLDDEAIAWVEDTLESLTVDEKIGQLFVPIGYSTEKEYLDHLASFNIGGLF
FRPGNAVEVRDTYQYIQEISKVPLLTTANLEDGGNGAAFEATAYGRQMAIAAANDPKFAY
TLGEIAAKDGKAVGVNWGFSPVIDLDFNFRNPITNVRTYGSDIDTVISNAKAYTKAFHDQ
HVMTSIKHFPGDGADERDQHLLTSVNHLSMPAWEKTFGLVYKELIDFGTKAVMVGHIALP
AFTGDDMPATLSPKILKDLLRKQLRFNGLVITDASPMVGFCAAMKRSEAIPYTIEAGCDM
LLFNRVFEEDVQYMKDGLANGILSHERLDEAVTRILAAKASLGLHKQIEHGSAMFEDRKK
DQAELADHSVTLVKDSQKLLPLSPEKHKRVLLQMLGNFDSNERVSQKVKTELEQLGFDVT
VYEPETNFWDLETVQSFSSKYDIVLYVANIENASNQTVARINWHTLFGLGNNLPWFVKEI
PTLLISFGNPYHLFDLPMVETVVNTYCNYDHFIEAGISKLVGKSPFKGVSPVNPFCNNDL
LKELNDAN
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattaacagaaaaaccattttatttggatgatgaagcaatagcttgggttgaa
gatacactggaaagtttaactgtagatgaaaaaatcggtcagctatttgttccaatcggc
tactcaaccgaaaaagaatacttggatcatttggcttcttttaacattggaggattattt
ttcagaccgggaaatgcagtagaagtgagagatacttatcagtatattcaagagattagt
aaagttccacttttaacaactgcaaacttagaagacggaggaaatggagctgcctttgaa
gcgacagcatatggtcgtcaaatggctattgctgcagctaatgatccgaaatttgcatat
actcttggagaaattgctgctaaagatggaaaagcagtaggagtaaattggggcttttcg
ccagtaatcgatttggattttaactttagaaacccgataacaaatgttcgaacatatggt
agtgatattgatacagttatttcaaatgctaaagcctatacgaaagcattccatgaccaa
catgttatgacttccataaaacattttccgggggatggtgctgatgagcgggatcaacac
ttattgacatctgttaaccacctatcaatgccagcttgggaaaaaacatttggattggtt
tataaagagttaattgattttggtaccaaggcagtcatggtgggacatattgctttacca
gcttttactggagatgatatgccagcgacattgagtccaaaaattttgaaagatttactt
cggaaacaacttaggtttaatggtttggtcattacagatgctagtccaatggtgggattc
tgtgcagcaatgaagcgtagtgaggccattccatatacgattgaggcgggctgtgatatg
ctattattcaatcgtgtttttgaagaggatgttcagtatatgaaagatggattagcaaat
ggaattctatctcatgagagattggacgaagctgttactcggatattagcagctaaagca
tctttaggcttacacaaacaaatcgaacatggttcagcaatgtttgaagatagaaaaaaa
gaccaagcggaacttgctgatcattctgtaacacttgtgaaggatagtcaaaaattgctt
cccctatctcccgaaaaacacaagagagttctgcttcaaatgttaggaaacttcgattcg
aatgaacgcgtaagtcaaaaggtaaaaactgagcttgaacaactcggttttgatgtgact
gtttatgaacccgaaacgaacttttgggatttagaaactgtgcagagtttttcaagtaaa
tatgatattgtgttgtatgtagctaatattgaaaatgcaagtaatcaaactgttgcacga
ataaattggcatacactatttggattaggaaataatcttccttggtttgtaaaggagatt
ccaactttgctaattagttttggaaatccctatcatttgtttgatttacctatggtagaa
actgttgtaaatacctattgtaattatgatcattttattgaagcaggaatttcgaaatta
gttggaaaaagtccatttaaaggtgttagtcctgtaaatccattttgtaacaatgatcta
ttaaaggagttgaatgatgcaaattga

DBGET integrated database retrieval system