KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10583Help
Entry
HMPREF0833_10583  CDS       T01545                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0833_10583 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10583 (glk)
   00052 Galactose metabolism
    HMPREF0833_10583 (glk)
   00500 Starch and sucrose metabolism
    HMPREF0833_10583 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_10583 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0833_10583 (glk)
   00524 Butirosin and neomycin biosynthesis
    HMPREF0833_10583 (glk)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     HMPREF0833_10583 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(600703..601662)
Genome map
AA seq 319 aa AA seqDB search
MSKKIIGIDLGGTSIKFAILTLDGEVQEKWSIKTNILDEGSHIVDDMIESIAHRLKMLGL
DASEFQGIGMGSPGVVDREKGTVIGAYNLNWKSLQPVKEKIESALHIPFFIDNDANVAAL
GERWKGAGENQPDVVFMTLGTGVGGGIVAEGRLLHGVRGAAGELGHITVDFDDPIQCTCG
KKGCLETVASATGIVNLTRRYADEYEGDSQLKVLIDNGEEVTAKTVFDLAKEGDALALIV
YKNFSRYLGLAAANIGSTLNPSKIVIGGGVSAAGEFLLEGVRKVFEENSFPQVRESTQLA
LATLGNDAGVIGAASLVLQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaattattgggattgaccttggaggaacttcgatcaaatttgccattctt
accttggatggagaggttcaagaaaaatggtctattaaaacaaatatcttggatgaaggt
agtcatattgtagatgatatgatcgaatcaatcgcgcatcgtttgaagatgcttgggctt
gatgcttctgagttccaaggaattggaatgggatcacctggtgtcgttgaccgtgaaaaa
ggtacagttatcggtgcctataacttgaactggaagagtcttcaaccagtaaaagaaaag
atcgaaagtgcccttcatattccatttttcattgataatgatgccaacgttgctgctttg
ggtgaacgttggaaaggagctggtgaaaaccaaccagatgttgttttcatgactcttgga
acaggtgtcggcgggggaatcgtcgctgaaggtcgcctcttgcatggtgtgcgtggagct
gcaggtgagcttggtcatatcaccgttgattttgatgatccgattcaatgtacctgtggt
aaaaaaggatgtctcgaaacggttgcatctgcaacaggtatcgttaacctcactcgtcgt
tatgccgatgagtacgaaggggactctcaattgaaagtcttgatcgacaatggtgaagaa
gtgaccgctaaaactgtctttgatctagcaaaagagggtgatgctcttgctttgatcgtc
tataagaacttctcacgttaccttgggcttgctgctgccaacatcggttcaaccttgaac
ccatctaagatcgttatcggtggtggagtttcggctgcaggtgaattccttttagaagga
gtgcgcaaagtctttgaagaaaactcattcccacaagtgcgtgaatcaacacaattggct
cttgctaccttgggaaatgatgccggtgtcattggtgcggcatcccttgttttacaatga

DBGET integrated database retrieval system