KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10743Help
Entry
HMPREF0833_10743  CDS       T01545                                 

Gene name
nagZ
Definition
beta-hexosaminidase A (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_10743 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    HMPREF0833_10743 (nagZ)
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0833_10743 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762288..764699)
Genome map
AA seq 803 aa AA seqDB search
MKKIIYPSAALLTAFALLSVQTAKADTAQASDQANEPAATVEEVVASPTPESTTENQGEV
AETPTSTDRAAVPAASPTVTSTETASPEVEKLIENMPLKQKVTQMIMPDFRKWQEANQES
PQDLTKVNAEVADAIDKYDFGGVILFAENVKETKQTLALTQDMQKAAIENKANNGKIPLL
LAIDQEGGIVYRLGTGTALPGNMAIGATNDPKLAKEAGQIIGRELSALGLNVDFAPVLDT
NNNPQNPVIGLRSFSSDPNRVAYLGIPMMKGIQDYNVAVAAKHFPGHGDTAVDSHTGLPL
VDKSLAELEKLELLPFKKAMDAGVDLLMTAHIQYPQIEKDQVVSKETGEKIYVPATLSDD
ILTGLVRKKYGYKGVIVSDAMGMDAIAKNFGEVEAVKMAIKAGVDLVLMPTTLRSKADLT
KIDTIVNAVVDAVQTGDISEERLNESVRRILTLKEKRGVLNFDPSARTAEKAGEAVGSTL
NRDLERKIAAAAVTVVKNEDNTLPFKVQTGDHVLLLGAFENEVPGLNLGMRRLIADGVLP
KDTSFVAKNFTKESTLDSLKEDLEKATHIVVISEIGYEGQLDKDFWRTKIPTEIVNYANT
NHKKAAVLSISKPYDVANYPAAKAILAVYGNKGMDPTESLKPDNAFGPNIPAGVEVIFNG
KEHLGTLPVDIPKIVDGKMSETEYAYRIGHGLFYPAPAPLPTPETQVPTSPVQDPTHQTQ
PVEVGHTGTQVLVSKQEKLSPLDGPQVTPISVSHDTAQAPASVSASPASSVLPKTGQTGN
LLSLMGISLLTFLGSFVYPRKKH
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcatttatccatctgcggccctattaacggcttttgctctattatccgtt
caaacagcaaaagcagacacagctcaagcgtcggatcaagccaatgaaccggcagcaaca
gtagaagaggtggtggcttctccaacgccagaaagcaccacagaaaatcagggagaagtg
gccgaaacgccgacttcaacagaccgtgcagctgttcctgctgcctccccaacggtaaca
tcgactgagacggcatcccctgaagtggaaaaactgattgaaaacatgccactcaaacaa
aaggtgactcaaatgatcatgccggacttccgtaagtggcaggaggctaatcaggagtca
ccacaggatctcaccaaggtcaatgctgaagtagcagatgcgattgataaatatgatttt
ggaggcgtcattctttttgctgaaaacgtaaaagagaccaagcaaactctggctctgacg
caagatatgcaaaaggcagcgattgaaaacaaagccaataacgggaagattccgctattg
ttagccatcgaccaagaaggagggatcgtctaccgcttgggtacgggtacagcccttcct
ggtaatatggctattggggctaccaatgatcccaaactagcgaaagaagcaggtcaaatc
atcggacgtgaactttctgcactaggattgaatgtggacttcgctccagttctagatacc
aataataatcctcaaaaccctgtgattgggcttcgttccttctcatctgatccaaaccgg
gttgcctacttgggtattccgatgatgaaaggcattcaggactacaatgtggctgtagca
gccaagcatttcccaggtcatggggatacggcggtcgattcgcatacgggtctccccttg
gtggataaatctcttgctgagcttgaaaaattggaactccttccattcaaaaaagccatg
gatgctggcgtagacctcttgatgacggctcatatccaatacccgcagattgaaaaagat
caggtcgtttcaaaagaaacgggtgagaaaatctatgttccagcgactctctctgatgat
attttaacgggcttggtacggaagaaatacggctataagggcgtgattgtctccgatgcc
atgggaatggatgctatcgctaagaacttcggtgaggtggaagctgtgaagatggccatc
aaagcaggagttgatttggtcttgatgccaacgacccttcgcagtaaagccgatttgacc
aagattgataccattgtcaatgcagtggtagatgcggtccaaaccggtgacatctcagaa
gaacgcttaaatgagtcggttcgccggattctgaccctcaaagaaaaacgtggggtcttg
aattttgatccaagtgctcggacagctgaaaaagcaggagaagcagtcggatctaccctc
aaccgtgacttggaacgcaagattgcagcagcagcggtgacggttgtaaaaaatgaagac
aataccttgccatttaaggtacaaacaggggaccatgtcttactcttaggagcttttgaa
aacgaagttcctggactcaatttgggcatgcgtcgcttaattgctgacggagtgcttcca
aaagatacctcctttgtggccaagaacttcactaaggaatccacccttgatagtctaaaa
gaagacctagagaaagcaactcacatcgtagtcatttcagagatcggatatgaagggcaa
ctggataaagatttctggcggaccaagatcccaacagagatcgtcaattatgccaatacc
aatcataagaaggcagctgtcctttctatctctaaaccttatgatgtagccaactatcca
gcagccaaagccattttggcagtctatggaaataagggaatggatccaacggaatccctc
aaaccagacaatgcatttggtcctaatattcctgcaggagtggaagtcatcttcaatggc
aaggaacatctaggtaccttaccggtggatattccaaaaattgtagatggaaaaatgtcg
gaaacagagtacgcctaccgcattggccatggtctcttctatccagcacctgctccattg
ccaacaccagaaacccaagttccaacttcaccagttcaagatccaacccatcagacacaa
ccagtagaggttggtcacactggaacacaggttcttgttagcaagcaagaaaagttgagc
cctcttgatggtccacaagtcactccgatttctgtatcacatgacactgctcaggctcct
gcaagtgtatctgctagtcctgcctcatcggtattgccaaagactggtcaaacagggaat
ctcctctccctcatgggcatcagcctcttaaccttccttggatcttttgtctatccaaga
aagaaacactaa

DBGET integrated database retrieval system