KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10744Help
Entry
HMPREF0833_10744  CDS       T01545                                 

Gene name
aga
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:scp00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:scp00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:scp00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(764858..767116)
Genome map
AA seq 752 aa AA seqDB search
MILGTLIQERINMRDLIFYQETYKQFHLRNDFISYIFMISHDGKLLHLYYGPTLPEGDYR
HLVEMKHRPMTTYRQEGDLLYSLEHLQQEFPEYGATDFRHPALELSFENGSRLTDFIYKD
HVILKGKPRLEGLPATYVENEDECQTLQVNLIDSVSGVEVSIQYSIFRDFPVITRSHLIN
NQGSRPLSIEGVTSLSLDLPDRNYEMIQLSGAWARERHIHSTLLRQGIQSIESTRGISSH
LHNPFIALKRPETTENQGEVIGLSLIYSGNFLLQAEVDTFDVTRLQVGINPFQFCWKLDP
GASFTSPEAVLVYSRNGLNDMSQTFHRLYRTRLARGEWRDKERPILLNNWEATYFDFDQE
KLLRIAQNAKEVGVELFVLDDGWFGKRTNDRTGLGDWVANRERFPDTIGALSEKIHDMGL
KFGLWFEPEMVNKDSDLYRTHPDWILEVAGHSPRHGRNQFVLDFSREEVVDAIYEQMARV
IEETKLDYIKWDMNRPLTDVFSKSLAPEQQGEVFHRYVLGLYHLYDRLTTAFPSILFESC
ASGGGRFDPGLLYYAPQTWTSDDTDAVERLKIQYGTSLVYPLSTMGAHVSIVPNHQTNRI
TPLTTRGNVAYFGVFGYELDLAELTQAEKEIVKEQIDFYKKERSLIHQGNFYRLRSPFDS
NQVVWSVVSQNRSRVILAQYKLLNEVNRAYDRVYLQGLKADALYEVDGKQYSGAELMLAG
FSLSDASCGQPLNQEKLSRDFDSHIWVFEEVK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgatactaggaactctgatacaagaaaggataaatatgagggacctcattttctaccag
gaaacatacaagcagtttcatctgcgaaatgattttatttcttatatctttatgatttcc
catgatgggaagttgctccatctttattatggaccgaccttgccagaaggggattatcgt
catttggtggaaatgaagcaccgcccaatgaccacttaccggcaagaaggggatcttctg
tattcacttgaacacttgcagcaagaatttccagagtatggggcgacagattttcgccat
cctgccttggaactgtcttttgaaaatggttctcggctgacagattttatctataaagat
catgtaattttaaagggaaaaccaagattagaaggtttaccagcaacttatgttgaaaac
gaggatgaatgccagaccttgcaagtgaatctgatcgattcggtgtcgggtgtggaagtg
agtattcagtatagtattttccgagacttccctgtgataacgagaagtcacctgatcaac
aatcaaggctcaaggcccctttctattgaaggagtcaccagtctttctttagacctacct
gatcgaaactatgagatgatacagctttctggagcgtgggctcgtgaaaggcacattcat
tccaccttgttacgtcaaggaatccaatcgattgaatcaacccgtggaatctctagtcat
ctgcacaatcctttcattgctctaaaacgacctgaaaccaccgagaatcagggggaggtt
attggactcagcctgatttactcaggaaatttccttcttcaagcagaagtggataccttc
gatgtcacccgccttcaagtgggaatcaatcccttccaattttgttggaaattagaccct
ggtgctagctttacaagtccagaagcagttctggtatacagtagaaatggtttaaacgat
atgagtcaaactttccatcgtctttatcgtacccgtctagctaggggagaatggcgagat
aaggagcggccgattctactcaataattgggaagcaacttactttgattttgatcaggaa
aaactgctcaggattgcgcaaaatgccaaagaagttggcgtcgaattatttgtcttagat
gacggctggtttggaaaacgaaccaatgatcgaacgggtcttggagattgggttgccaat
cgcgagcgatttccagacacaatcggggctttatcagagaaaattcatgatatgggcttg
aaattcggcctttggtttgaaccggaaatggtcaacaaagatagcgatctttatcgtaca
catccggactggatcctagaagtagcaggtcattccccacgtcatggacgaaatcaattt
gtcttagattttagtcgtgaagaagtagtagatgccatttatgaacaaatggcacgggtg
attgaagagacaaaattagactatattaagtgggatatgaaccgtccgcttacggatgtc
ttttctaaatccttggctccagagcagcaaggagaagtgtttcatcgttatgttcttgga
ttataccacttatatgatcgtttaacgacagcattcccttctattctctttgaatcttgt
gcttcaggaggcggtagatttgatccaggtttgctttattatgcacctcaaacttggacc
agtgatgatacagatgccgttgaacggcttaagatccaatacggaactagtctagtttat
ccactctcgacgatgggagcacatgtgtccattgtccctaaccaccaaaccaatcggatc
acaccgcttacgacaaggggaaatgtcgcttattttggggtctttggttacgagttggat
ctagctgagctgacgcaggctgagaaggaaatcgtaaaagaacaaattgacttttacaaa
aaagagcgatccctgattcatcaaggaaatttttaccgtttgcgctctccttttgactca
aatcaagtcgtatggtcggttgtcagtcaaaatcgttcccgagtgattctggctcagtat
aagctattaaacgaagtgaaccgtgcctatgatcgtgtgtatcttcaaggactgaaggca
gacgctctctatgaagtggatgggaaacagtatagtggtgcagaactgatgttagcaggc
tttagtctttcagacgcttcctgtggccagcctttaaatcaagagaaactgagtcgtgat
tttgactctcacatttgggtttttgaagaagtaaaataa

DBGET integrated database retrieval system