KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10745Help
Entry
HMPREF0833_10745  CDS       T01545                                 

Gene name
scrP2
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0833_10745 (scrP2)
Enzymes [BR:scp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     HMPREF0833_10745 (scrP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(767306..768748)
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYENLEKHFGDAVGGVHLLPFFPSTGDRGFAPVDYDQV
DPAFGDWEDVKRLGDKYYLMFDFMINHISRQSKYYKDYQEKHDQSAYKDLFLNWDKFWPE
NRPTQADVDLIYKRKDRAPKQAITFADGTTEHLWNTFGEEQIDLDVTKEVTMDFIRKTIE
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDMAAGYGAELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYSLYSSKVDRLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSTAEYNNLDIYQINSTYYSALGDDDRKYFLARLI
QAFAPGIPQVYYVGFLAGKNDLELLENTKEGRNINRHYYSNEEIAQEVERPVVQSLLKLF
SFRNNSQAFDLEGSIEVETPDDHTIVITRQNKDQTVTAVARIDLAEGTYQVTENGQEMVF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcaaaacaaaaccatgttaattacttactcagatagcttaggaaataacctt
aaggatctctatgaaaatctggagaaacattttggagatgcagtaggtggggttcacctc
ttgccatttttcccatcaactggtgaccgtggctttgcgcctgtggactatgaccaagtg
gatccagcctttggagattgggaagatgtcaaacgcttgggtgacaagtattatcttatg
tttgactttatgatcaatcacatttcccgtcagtctaaatactacaaggactaccaggaa
aagcatgaccaaagtgcctataaggatctctttctcaactgggacaagttctggccagag
aatcgcccaactcaagcagatgtagatttgatttataagcgcaaagaccgagctcccaag
caagccatcacttttgcggatgggacgaccgagcatctctggaatactttcggggaagag
cagattgacctagacgtgaccaaggaagtgaccatggactttattcgcaagaccatcgaa
cacctggcaagcaatggctgtgacctcattcgtttggacgcctttgcctatgcggtgaag
aaattggacaccaatgatttctttgtggaaccagatatttgggatttgttggataaggta
cgcgatatggcggcaggctacggtgctgagcttcttccagagattcatgagcactattcc
atccagtttaagattgctgaccacgattattatgtctatgacttcgcgcttccaatggtg
accctctatagcctctatagttcaaaagtggatcgccttgccaagtggttgaagatgagt
ccgatgaagcagttcacgacgctggatacccatgatggaattggggtggttgatgtcaag
gatatcttgacagatgaagagattgactatgcttcaaatgagctttataaggttggggca
aatgttaaacgcaaatattcaacagcagaatacaacaacttggacatctaccaaatcaat
tcgacctactattcagctctcggagatgatgatcgcaagtacttcctagcccgtttaatt
caagcctttgcaccaggtattccacaggtttattatgttggattcctagctgggaagaat
gatttggaacttttagaaaacaccaaagaaggccgcaatatcaaccgtcattactacagc
aacgaagaaattgcgcaagaagtagagcggccagtcgtgcaatcacttctcaagctcttt
agtttccggaataactcgcaagcttttgacctagaaggaagcattgaggtggaaacacca
gatgatcataccattgtcatcacgcgccaaaacaaagaccagactgtcacagcagtagcc
cgaattgatcttgctgagggcacttaccaagtgacagaaaatggtcaagaaatggtgttt
taa

DBGET integrated database retrieval system