KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10749Help
Entry
HMPREF0833_10749  CDS       T01545                                 

Gene name
aga2
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0833_10749 (aga2)
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0833_10749 (aga2)
   00600 Sphingolipid metabolism
    HMPREF0833_10749 (aga2)
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF0833_10749 (aga2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(772006..774180)
Genome map
AA seq 724 aa AA seqDB search
MEEDMAIRIEQNLFYVESKGLSLILENRDGYLMLKHLGRPIPSYHFSNTVHEKDHAFSGN
PTPDIRTFSLDTQRQVLGQHGLGDFRKPSIQIQHGATEVTDFLYVGANIYSGSVEATGLP
NPYSVDQAETLALVFEDDQAALRLTIYYTAYEDRATITSFSKIENYSDETVVIHKALSVL
ADVPAGDYDVITLQGAYAREKTVCRQQVEQGIFSISSNRGASGHAQTPALILADHEVTED
AGSALAFQLLYSGNFEGFVQKNQLSEVRVGLGINPENFSWELAPNQSFDTPVAMISYSHE
GLTGLSQESQAFVQNHIIPSQFAHKERPILINNWEATYFDFKKDKLLELADEAQKVGIEL
FVLDDGWFGNRFDDNRALGDWTVNEEKLGGSLAELIQGIHEKGLQFGLWVEPEMISVDSD
LYRAHPDWAIQVPGYEHTYSRNQLVLDFANKEVVAYIKQVLDDLLGNHEIDYIKWDMNRN
ITKLGNGKTYLETKMQSHAYILGLYEVVSYLTEKYENILFESCSGGGGRNDLGMMRYFPQ
VWASDNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGY
ELDLTSLPQEELDRIAAQVAHYKTIRPLVQFGKHYRLINPSQGSNQAAVQFTYQDRTVVT
YVRVLSTVEEIEPTLKLKGLEEDALYRLEGTDQVYSGAELMYAGLTVVLPQGDFLSKQYV
FVKK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagatatggcaattcgtatcgaacaaaatttgttctatgtagaaagtaaggga
ttgagccttatccttgaaaatcgcgatggctacctgatgcttaagcatttgggacgtccg
attccgtcttatcatttttccaatacggtgcatgagaaggaccatgctttctcaggaaat
cccacacctgatattcgaaccttcagtttggatacccagcgtcaggtcttaggacaacat
gggcttggagattttcgaaagccgtcgatccagatccagcacggcgccacagaggtgacg
gatttcctctatgtcggagccaatatatactctggtagtgtcgaggcgaccggccttcct
aatccttactcagtagatcaggctgaaaccttggccttggtctttgaagatgatcaagcg
gctcttcgtttgaccatatactacacagcctacgaggaccgggcaaccatcactagcttt
tcaaagattgaaaactatagtgatgaaacggttgtgatccataaggctcttagtgtgttg
gcagatgtcccagcaggtgactacgatgtcatcaccctacaaggggcctatgcaagagaa
aaaacagtctgccgccagcaagtagagcaaggaatcttctccatcagctctaaccgcggt
gcttctggacacgctcagactcctgcccttattctagcagatcatgaagtgaccgaagat
gccggttctgcccttgccttccaactgctctacagtggaaattttgaaggatttgttcaa
aaaaatcaactcagtgaagttcgggttggattgggaatcaatccagaaaacttctcctgg
gagttggcgccaaatcagagctttgataccccagtagccatgattagctactcacatgag
ggcttgaccggtctcagtcaagagagccaagcatttgtccaaaaccatatcattcctagc
caatttgcccataaagaacgcccaattcttatcaacaactgggaagccacctactttgac
ttcaagaaagacaagttattggagctggcagatgaggctcaaaaagtagggattgaactc
ttcgttcttgatgatggctggtttggcaatcgctttgatgacaatcgggctctcggtgac
tggactgtcaatgaagaaaaattaggaggcagcctagcagaactgattcagggcatccat
gaaaagggacttcaatttggcctttgggtggagccagaaatgatttcggttgatagcgac
ctctatcgggctcatccggactgggctattcaagtcccaggctatgaacacacctattca
cggaatcaactagtactcgatttcgcaaataaagaagtagtggcttatattaagcaggtc
ttggatgacttacttggaaatcatgagatcgactatatcaaatgggacatgaatcgcaat
atcactaagcttgggaatgggaaaacctaccttgaaaccaagatgcaatcccatgcgtat
attttaggtctctatgaagtggtttcttacttgacagagaagtacgagaatatcctcttt
gagtcttgctccggtggtggtggccgcaatgaccttggtatgatgcggtacttcccgcag
gtctgggcaagtgacaatacggatgccattgccagacttccgatccagtatggatccagt
tatctctatccaactatttccatgggggctcacgtatcagctgttccaaatcaccagatg
ggacggatgacaccacttgaaacgcgaggtcatgtagccatgatgggaaatctaggctat
gaattggatctaaccagtcttccgcaagaagagttggatcggatcgcagctcaagtcgct
cattacaaaacgattcgaccacttgttcaattcggaaaacactaccgcttgatcaatcca
agccaaggtagcaatcaagcagccgtccagttcacttatcaagaccgcacggttgtaact
tatgtacgggtcttatcaacggttgaggagatcgagccgaccctgaaactcaaaggattg
gaagaagatgcgctctatcgcttagaagggactgaccaagtctattcaggagctgagctc
atgtatgccggcttaaccgtcgttcttcctcagggagatttcctcagcaaacaatatgtt
tttgtcaaaaaataa

DBGET integrated database retrieval system