KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10749Help
Entry
HMPREF0833_10749  CDS       T01545                                 

Definition
(GenBank) alpha-galactosidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00052  Galactose metabolism
scp00561  Glycerolipid metabolism
scp00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    HMPREF0833_10749
  Lipid metabolism
   00561 Glycerolipid metabolism
    HMPREF0833_10749
   00600 Sphingolipid metabolism
    HMPREF0833_10749
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     HMPREF0833_10749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 GHL10 GHL6 Melibiase_2 AF0941-like
Motif
Other DBs
NCBI-ProteinID: AEH55780
UniProt: F8DI63
Position
complement(772006..774180)
Genome map
AA seq 724 aa AA seqDB search
MEEDMAIRIEQNLFYVESKGLSLILENRDGYLMLKHLGRPIPSYHFSNTVHEKDHAFSGN
PTPDIRTFSLDTQRQVLGQHGLGDFRKPSIQIQHGATEVTDFLYVGANIYSGSVEATGLP
NPYSVDQAETLALVFEDDQAALRLTIYYTAYEDRATITSFSKIENYSDETVVIHKALSVL
ADVPAGDYDVITLQGAYAREKTVCRQQVEQGIFSISSNRGASGHAQTPALILADHEVTED
AGSALAFQLLYSGNFEGFVQKNQLSEVRVGLGINPENFSWELAPNQSFDTPVAMISYSHE
GLTGLSQESQAFVQNHIIPSQFAHKERPILINNWEATYFDFKKDKLLELADEAQKVGIEL
FVLDDGWFGNRFDDNRALGDWTVNEEKLGGSLAELIQGIHEKGLQFGLWVEPEMISVDSD
LYRAHPDWAIQVPGYEHTYSRNQLVLDFANKEVVAYIKQVLDDLLGNHEIDYIKWDMNRN
ITKLGNGKTYLETKMQSHAYILGLYEVVSYLTEKYENILFESCSGGGGRNDLGMMRYFPQ
VWASDNTDAIARLPIQYGSSYLYPTISMGAHVSAVPNHQMGRMTPLETRGHVAMMGNLGY
ELDLTSLPQEELDRIAAQVAHYKTIRPLVQFGKHYRLINPSQGSNQAAVQFTYQDRTVVT
YVRVLSTVEEIEPTLKLKGLEEDALYRLEGTDQVYSGAELMYAGLTVVLPQGDFLSKQYV
FVKK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagatatggcaattcgtatcgaacaaaatttgttctatgtagaaagtaaggga
ttgagccttatccttgaaaatcgcgatggctacctgatgcttaagcatttgggacgtccg
attccgtcttatcatttttccaatacggtgcatgagaaggaccatgctttctcaggaaat
cccacacctgatattcgaaccttcagtttggatacccagcgtcaggtcttaggacaacat
gggcttggagattttcgaaagccgtcgatccagatccagcacggcgccacagaggtgacg
gatttcctctatgtcggagccaatatatactctggtagtgtcgaggcgaccggccttcct
aatccttactcagtagatcaggctgaaaccttggccttggtctttgaagatgatcaagcg
gctcttcgtttgaccatatactacacagcctacgaggaccgggcaaccatcactagcttt
tcaaagattgaaaactatagtgatgaaacggttgtgatccataaggctcttagtgtgttg
gcagatgtcccagcaggtgactacgatgtcatcaccctacaaggggcctatgcaagagaa
aaaacagtctgccgccagcaagtagagcaaggaatcttctccatcagctctaaccgcggt
gcttctggacacgctcagactcctgcccttattctagcagatcatgaagtgaccgaagat
gccggttctgcccttgccttccaactgctctacagtggaaattttgaaggatttgttcaa
aaaaatcaactcagtgaagttcgggttggattgggaatcaatccagaaaacttctcctgg
gagttggcgccaaatcagagctttgataccccagtagccatgattagctactcacatgag
ggcttgaccggtctcagtcaagagagccaagcatttgtccaaaaccatatcattcctagc
caatttgcccataaagaacgcccaattcttatcaacaactgggaagccacctactttgac
ttcaagaaagacaagttattggagctggcagatgaggctcaaaaagtagggattgaactc
ttcgttcttgatgatggctggtttggcaatcgctttgatgacaatcgggctctcggtgac
tggactgtcaatgaagaaaaattaggaggcagcctagcagaactgattcagggcatccat
gaaaagggacttcaatttggcctttgggtggagccagaaatgatttcggttgatagcgac
ctctatcgggctcatccggactgggctattcaagtcccaggctatgaacacacctattca
cggaatcaactagtactcgatttcgcaaataaagaagtagtggcttatattaagcaggtc
ttggatgacttacttggaaatcatgagatcgactatatcaaatgggacatgaatcgcaat
atcactaagcttgggaatgggaaaacctaccttgaaaccaagatgcaatcccatgcgtat
attttaggtctctatgaagtggtttcttacttgacagagaagtacgagaatatcctcttt
gagtcttgctccggtggtggtggccgcaatgaccttggtatgatgcggtacttcccgcag
gtctgggcaagtgacaatacggatgccattgccagacttccgatccagtatggatccagt
tatctctatccaactatttccatgggggctcacgtatcagctgttccaaatcaccagatg
ggacggatgacaccacttgaaacgcgaggtcatgtagccatgatgggaaatctaggctat
gaattggatctaaccagtcttccgcaagaagagttggatcggatcgcagctcaagtcgct
cattacaaaacgattcgaccacttgttcaattcggaaaacactaccgcttgatcaatcca
agccaaggtagcaatcaagcagccgtccagttcacttatcaagaccgcacggttgtaact
tatgtacgggtcttatcaacggttgaggagatcgagccgaccctgaaactcaaaggattg
gaagaagatgcgctctatcgcttagaagggactgaccaagtctattcaggagctgagctc
atgtatgccggcttaaccgtcgttcttcctcagggagatttcctcagcaaacaatatgtt
tttgtcaaaaaataa

DBGET integrated database retrieval system