KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10803Help
Entry
HMPREF0833_10803  CDS       T01545                                 

Gene name
gpo
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:scp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:scp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830151..830633
Genome map
AA seq 160 aa AA seqDB search
MTSIYDFSLENQKGEEIPLSHYQGKVLIVVNTATGCGLTPQYQGLQDLYLRYQEKGLEIL
DIPCNQFMGQAPGTAEEINSFCSLNYQTTFPRFAKAKVNGKEALPLYDWLKSQAAGPLGK
RIEWNFAKFVIGRQGQVAQRFSSKTEPAAMEDLIQELLEK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactagcatttatgatttttctttagaaaaccagaaaggggaggagattcccctttct
cactaccaaggtaaggtcctcatcgtggtcaatacagcaacaggctgtggcttgaccccg
caataccaaggactgcaagatctctacctgcgctaccaggaaaaaggacttgaaattcta
gacattccctgtaaccaattcatggggcaggcaccaggaacggcagaagaaatcaatagc
ttctgtagcctcaactaccagaccaccttcccacgattcgctaaagccaaggtcaatggt
aaagaagcccttcctctctatgactggcttaaaagccaagcagctgggccactgggcaaa
cgcatcgaatggaacttcgcaaaatttgtcatcggccgacaaggccaagtcgcccaacgc
ttctcctccaaaacagagccagctgctatggaagacttgatccaagaattgcttgaaaaa
taa

DBGET integrated database retrieval system