KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_10858Help
Entry
HMPREF0833_10858  CDS       T01545                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0833_10858 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0833_10858 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_10858 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0833_10858 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0833_10858 (tpiA)
Enzymes [BR:scp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0833_10858 (tpiA)
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HMPREF0833_10858 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0833_10858 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0833_10858 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888785..889543)
Genome map
AA seq 252 aa AA seqDB search
MSRKPFIAGNWKMNKNPEEAKAFVEAVASKLPSADLVEAGIAAPAVDLTTVLAAAKGSNL
KVAAQNTYFENAGAFTGETSPQVLKEIGTDYVVIGHSERRDYFHETDEDINKKAKAIFAN
GMLPIICCGESLETYEAGKAAEFVGAQVSAALAGLTAEQVASTVIAYEPIWAIGTGKSAS
QDDAQKMCKVVRDVVATDFGQEVADKVRVQYGGSVKPENVAEYMACPDVDGALVGGASLD
PESFLALLDFVK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccatttatcgctggtaactggaaaatgaacaaaaatccagaagaagca
aaagcatttgttgaagctgtagcatcaaaacttccttcagctgatcttgttgaagctgga
atcgcggctcctgcagttgacttgactacagtacttgctgctgctaaaggttcaaacctt
aaagttgctgcccaaaacacttactttgaaaatgctggtgccttcactggtgaaactagc
ccacaagttttgaaagaaatcggtactgactacgttgttatcggtcactcagaacgtcgt
gactacttccacgaaactgatgaagacatcaacaaaaaagcaaaagcaatctttgcgaac
ggtatgcttccaatcatctgttgtggtgaaagccttgaaacttacgaagctggtaaagca
gcagaattcgtaggtgctcaagtttcagctgctcttgctggattgactgcagaacaagtc
gcttcaacagttatcgcatatgaaccaatctgggctatcggtactggtaaatcagcttca
caagacgacgcacaaaaaatgtgtaaagttgttcgtgacgttgtagctactgactttggt
caagaagtggctgataaagttcgtgttcaatacggtggttcagttaaacctgagaacgtt
gctgaatacatggcttgtccagacgttgacggagctcttgtaggtggtgcatcacttgat
ccagaaagcttcttggcattgcttgacttcgttaaataa

DBGET integrated database retrieval system