KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11192Help
Entry
HMPREF0833_11192  CDS       T01545                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11192
   00500 Starch and sucrose metabolism
    HMPREF0833_11192
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HMPREF0833_11192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1242485..1243924)
Genome map
AA seq 479 aa AA seqDB search
MTDKLQFPDGFLWGGATAANQCEGAYNEDGRGLANVDVVPIGPDRHAIITGQKKMFDFEE
GYFYPAKDGIDMYHRYKEDIALFGEMGFKTYRLSIAWSRIFPKGDELEPNEAGLQFYEDL
FKECHKYGIEPLVTITHFDCPMHLITEYGGWRSRKMLECYERLCRTLFTRYKGLVKYWLT
FNEINMILHAPFMGAGLCFEEGENEEQVKYQAAHHELVASAIATKLAHEIDPNNKVGCML
AAGQNYPHTCAPRDVWAGLEEDRKNYFFIDVQARGEYPNYAKKEWERQGITVEMTEQDLQ
LLKDHTVDFISFSYYASRVASGDPAEREKTAGNIFASLKNPYLESSEWGWQIDPLGLRIT
LNTIWDRYQKPMFIVENGLGAVDTPNEAREIEDDYRIDYLAAHVKAMREAINEDGVVLWG
YTTWGCIDLVSAGTGEMKKRYGFIYVDRDNEGKGSLARSRKKSFYWYKEVIATNGASVN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaaacttcaatttccagatggtttcctttggggtggtgcgacggctgctaac
cagtgtgagggagcatataatgaagatggccgtggcttggccaatgtggatgtggtgccg
attgggcctgatcgtcacgccattattacgggtcagaaaaagatgttcgactttgaagag
ggctatttttatccagctaaggatggcattgatatgtaccatcgctacaaggaagacatt
gctctctttggggaaatgggctttaaaacctatcgtttgtccattgcctggtctcggatc
ttccctaaaggagatgaactagagccgaatgaggcaggcctacagttctatgaagacctc
tttaaggagtgccataagtatggcattgaacccttggtgaccattacccactttgactgt
cccatgcatttgattaccgagtatggaggttggcgtagtcgtaagatgttggaatgttat
gaacgactctgccggaccctcttcactcgctacaagggcttggtcaaatactggctgacc
tttaatgagatcaatatgatcctccatgcgccttttatgggagcaggtctctgctttgaa
gaaggggagaatgaggagcaagtcaaataccaggcagctcaccatgaattggttgcttca
gccattgctaccaagctagcccatgagattgatcctaacaataaggtcggctgtatgctt
gcagcagggcaaaactatccgcatacctgtgctccacgagatgtctgggctggtctagaa
gaagaccgcaaaaactatttcttcatcgatgtgcaggcgcgtggggaataccctaactat
gccaagaaagagtgggagcgtcagggaatcacggttgagatgacggagcaggacctgcaa
ttgttgaaagaccatacagtggactttatttccttctcctactatgctagtcgggtcgct
tcaggggatccagctgaaagggagaaaacagcgggcaatatctttgcctctctgaagaat
ccctacctagaaagctcagaatggggttggcagattgaccctcttggtctccgcattacg
ctgaacaccatctgggatcgttatcaaaaacccatgtttattgtagaaaatggactaggt
gccgttgataccccaaatgaagccagggagattgaggatgactatcggattgattacctc
gcagcccatgtcaaggccatgcgggaggccatcaacgaagatggcgttgtcctctggggt
tatacgacttggggctgtattgacctggtctctgccgggacaggagaaatgaagaaacgc
tacggctttatctatgtcgaccgggacaacgaaggcaagggaagcttggcccgctcacgt
aagaaatccttctattggtacaaagaagtcattgcgacaaatggggcttctgtcaattaa

DBGET integrated database retrieval system