KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11309Help
Entry
HMPREF0833_11309  CDS       T01545                                 

Gene name
gltX
Definition
glutamate--tRNA ligase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:scp00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376061..1377521)
Genome map
AA seq 486 aa AA seqDB search
MAKDIRVRYAPSPTGLLHIGNARTALFNYLYARHHGGTFIIRIEDTDRKRHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLELYQKYIDQLLAEGKAYKSYVTEEELAAERERQE
AAGETPRYINEYLGMSEEEKAAYIAEREAAGIIPTVRLVVNESGIYKWHDMVKGDIEFEG
GNIGGDWVIQKKDGYPTYNFAVVIDDHDMQISHVIRGDDHIANTPKQLMVYEALGWEAPE
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYLPEAVFNFIALLGWNPGGEDEIFSR
EELIKLFDENRLSKSPAAFDQKKMDWMSNEYIKNADLATIFEMAKPFLEEAGRLTDKAEK
LVELYKPQMKSVDEIVPLTDLFFSDFPELTEAEKEVMAGETVPTVLEAFKAKLEAMSDDE
FVAENIFPQIKAVQKETGIKGKNLFMPIRIAVSGEMHGPELPDTIYLLGREKSIQHIESM
LEKITK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagatattcgtgtgcgttatgcaccaagtccaacagggctattacacatcgga
aacgctcgtacagcattgtttaactacttgtatgcgcgtcaccatggtggaacctttatc
atccgtatcgaagatacggaccgcaaacgtcacgtcgaagacggagaacgttcacagctt
gaaaaccttcgttggttgggcatggactgggacgaaagtccagagacgcatgaaaactac
cgccaatcagaacgcttggaactctatcaaaaatacattgaccaattgctagctgaagga
aaagcctataaatcttacgtcactgaagaagagttggcagctgaacgtgaacgtcaagaa
gcagctggggaaacacctcgctacatcaatgaatacctcggcatgagcgaagaagaaaaa
gcagcttatatcgcagaacgtgaagcagcaggcatcattccaactgttcgtctggtggtg
aatgagtctggtatctacaaatggcatgacatggtcaaaggcgatatcgagtttgaaggt
ggcaatatcggtggggactgggtcatccaaaagaaagatggttatccaacttacaacttt
gccgttgtgatcgatgaccacgatatgcaaatttctcacgtcatccgtggagatgaccac
attgccaacaccccaaaacaactcatggtctatgaagcccttggctgggaagcgccagag
ttcggtcacatgaccttgatcatcaactctgaaactggtaagaagttgtctaaacgtgat
accaatacccttcagttcatcgaagattaccggaagaaaggttaccttccagaagcagtc
tttaactttatcgctcttcttggttggaaccctggtggggaagacgaaatcttctctcgc
gaagaactcatcaagctctttgatgaaaatcgtctcagcaagtctccagcagctttcgac
cagaagaaaatggactggatgagcaatgagtatatcaagaatgcggatcttgcgaccatc
tttgaaatggcaaaaccattcctcgaagaagcaggacgtttgacagacaaggctgagaaa
ttggttgaactctacaaaccacaaatgaaatcagtggatgaaatcgttccattgacagac
ctcttcttctcagacttcccagaattgacagaagcagagaaagaagtcatggctggtgaa
acagtgccaactgtacttgaagccttcaaagcgaaactcgaagccatgtcagacgatgag
tttgtggcagaaaatatcttcccacaaatcaaagcggttcaaaaagaaactggtatcaaa
gggaaaaacctctttatgccaatccgaatcgccgtttcaggtgagatgcatggtcctgaa
ttgccagataccatctacttgcttggacgcgaaaaatccatccaacacattgaaagcatg
ttggaaaaaattacaaaataa

DBGET integrated database retrieval system