KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11330Help
Entry
HMPREF0833_11330  CDS       T01545                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0833_11330 (galU)
   00052 Galactose metabolism
    HMPREF0833_11330 (galU)
   00500 Starch and sucrose metabolism
    HMPREF0833_11330 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_11330 (galU)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0833_11330 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1419806..1420714
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNDPFVVMLGDDLMDITNDDALPLTKQLMNDYDETHASTIAVMEVPHEEVSSYGVIAPQG
EGINGLYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFAILENQEPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDLKQYIIELGKELEASEKT
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttagaaaagcagtcattcctgcggctggtttggggacacgcttcctccca
gctactaaagccttggccaaggaaatgttgccaatcgttgacaaacctacgatccaattt
atcgtagaagaggctctgaaatctgggattgaggaaatccttgtcgtaacagggaaggcc
aaacgttcgatcgaagaccatttcgattctaacttcgaattagaatacaatctcgagcaa
aaaggcaagactgacttactcaagttggtcaatgatacaacagcgatcaatcttcacttc
atccgccaaagtcaccctcgaggtttaggagacgcggttcttcaagccaaggcctttgtt
ggaaacgatccttttgtcgtcatgctgggagatgacctcatggacatcactaatgatgat
gccttgccacttaccaaacaattgatgaacgactacgatgaaacccatgcgtcaactatc
gctgtgatggaagtccctcacgaagaggtttcttcttacggtgtgatcgcacctcaaggc
gaagggattaacggtctttatagcgttgaaacttttgtcgaaaaaccaaacccagaggat
gcgccaagtaatctcgctatcattggacgctacctcttaactcctgagatctttgcgatc
cttgaaaatcaagaaccaggtgctggaaatgaaattcaattgacggatgcgattgacacg
ctcaataaaacacagcgcgtctttgctcgtgaattcactggagatcgctatgacgtcggt
gataaattcggctttatgaaaacttcgatcgactatgccttgaaacaccctcaagtcaaa
gatgatctcaaacaatatattatcgaactcggaaaagaattagaagcgtctgaaaaaact
gcagactaa

DBGET integrated database retrieval system