KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11330Help
Entry
HMPREF0833_11330  CDS       T01545                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00040  Pentose and glucuronate interconversions
scp00052  Galactose metabolism
scp00500  Starch and sucrose metabolism
scp00520  Amino sugar and nucleotide sugar metabolism
scp01100  Metabolic pathways
scp01130  Biosynthesis of antibiotics
Module
scp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0833_11330 (galU)
   00052 Galactose metabolism
    HMPREF0833_11330 (galU)
   00500 Starch and sucrose metabolism
    HMPREF0833_11330 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_11330 (galU)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HMPREF0833_11330 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEH56361
UniProt: F8DKJ2
Position
1419806..1420714
Genome map
AA seq 302 aa AA seqDB search
MTKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEALKSGIEEILVVTGKA
KRSIEDHFDSNFELEYNLEQKGKTDLLKLVNDTTAINLHFIRQSHPRGLGDAVLQAKAFV
GNDPFVVMLGDDLMDITNDDALPLTKQLMNDYDETHASTIAVMEVPHEEVSSYGVIAPQG
EGINGLYSVETFVEKPNPEDAPSNLAIIGRYLLTPEIFAILENQEPGAGNEIQLTDAIDT
LNKTQRVFAREFTGDRYDVGDKFGFMKTSIDYALKHPQVKDDLKQYIIELGKELEASEKT
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttagaaaagcagtcattcctgcggctggtttggggacacgcttcctccca
gctactaaagccttggccaaggaaatgttgccaatcgttgacaaacctacgatccaattt
atcgtagaagaggctctgaaatctgggattgaggaaatccttgtcgtaacagggaaggcc
aaacgttcgatcgaagaccatttcgattctaacttcgaattagaatacaatctcgagcaa
aaaggcaagactgacttactcaagttggtcaatgatacaacagcgatcaatcttcacttc
atccgccaaagtcaccctcgaggtttaggagacgcggttcttcaagccaaggcctttgtt
ggaaacgatccttttgtcgtcatgctgggagatgacctcatggacatcactaatgatgat
gccttgccacttaccaaacaattgatgaacgactacgatgaaacccatgcgtcaactatc
gctgtgatggaagtccctcacgaagaggtttcttcttacggtgtgatcgcacctcaaggc
gaagggattaacggtctttatagcgttgaaacttttgtcgaaaaaccaaacccagaggat
gcgccaagtaatctcgctatcattggacgctacctcttaactcctgagatctttgcgatc
cttgaaaatcaagaaccaggtgctggaaatgaaattcaattgacggatgcgattgacacg
ctcaataaaacacagcgcgtctttgctcgtgaattcactggagatcgctatgacgtcggt
gataaattcggctttatgaaaacttcgatcgactatgccttgaaacaccctcaagtcaaa
gatgatctcaaacaatatattatcgaactcggaaaagaattagaagcgtctgaaaaaact
gcagactaa

DBGET integrated database retrieval system