KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11529Help
Entry
HMPREF0833_11529  CDS       T01545                                 

Gene name
adh
Definition
(GenBank) aldehyde-alcohol dehydrogenase 2
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00010  Glycolysis / Gluconeogenesis
scp00620  Pyruvate metabolism
scp00625  Chloroalkane and chloroalkene degradation
scp00626  Naphthalene degradation
scp00650  Butanoate metabolism
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01120  Microbial metabolism in diverse environments
scp01130  Biosynthesis of antibiotics
scp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11529 (adh)
   00620 Pyruvate metabolism
    HMPREF0833_11529 (adh)
   00650 Butanoate metabolism
    HMPREF0833_11529 (adh)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0833_11529 (adh)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0833_11529 (adh)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0833_11529 (adh)
   00626 Naphthalene degradation
    HMPREF0833_11529 (adh)
Enzymes [BR:scp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0833_11529 (adh)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0833_11529 (adh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 AdoMet_dc
Motif
Other DBs
NCBI-ProteinID: AEH56560
UniProt: F8DG81
Position
1650279..1652930
Genome map
AA seq 883 aa AA seqDB search
MADKKTLSPEEKKLAAEKHVDELVQKALVALEEMRKLNQEQVDYIVAKASVAALDAHGEL
ALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVISEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKALISLKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVEEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPAAWIAEQAGFSVPEGTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIEYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
ERGTEIMRAFKPDTIVALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPCSTPEEAVEAYAKAVYELGERCGIEMNFKAQGIDEKEWKKHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactctctcacctgaagaaaagaaactcgctgctgaaaaacacgta
gacgagttggtgcaaaaagcgctggtggcgcttgaagaaatgcgcaaattgaatcaggaa
caagtggactacattgttgcgaaagcatctgtagctgctcttgacgcacacggtgaactc
gctcttcatgcatatgaagaaactggtcgtggggtctttgaagacaaagcgaccaagaac
ttgttcgcttgtgaacacgttgtgaataacatgcgtcacacgaagacagttggtgtcatt
tcagaagatgacgtcactggtttaacgctaattgctgagccagtcggagttgtctgcggg
atcactcctacaacaaaccctacttcaacagcaatctttaaagcattgatttccttgaag
acacggaaccctatcgtctttgccttccacccatctgctcaagaatcatcagctcatgcg
gcacaaatcgtacgcgatgcggcaattgcagctggagcacctgagaactgtgtgcaatgg
attacccaaccttctatggaagcaaccagtgcccttatgaaccatgaaggagttgctacg
atccttgcgaccggtgggaatgccatggtgaaagcggcatactcatgtgggaaaccagct
cttggggtcggtgccggaaacgtacctgcttatgttgaaaaatcagctaatatccgccaa
gcagcacacgatatcgtcatgtctaaatcatttgacaacggaatggtttgtgcgtctgaa
caagcggtcatcatcgataaagaaatctacgatgagtttgttgaagaattcaaatcttac
cacacttactttgttaacaaaaaagaaaaagcccttcttgaagagttctgcttcggcgta
aaagcgaacagcaagaactgtgcgggtgcgaaattgaatgcggacatcgttgggaaacca
gcagcatggatcgctgaacaagctggcttctcagtcccagaaggaaccaatatccttgct
gcagaatgtaaagaagttggtgaaaaagaaccgttgactcgtgaaaaattgtcaccagtc
atcgctgtcttgaaatctgaaagccgtgaagacggaattaacaaagctcgccaaatggtt
gaattcaacggtcttggtcactcagcagccatccatactgctgatgaagaattgaccaaa
gaatttggtaaagcagtcaaagctattcgtgttatctgcaactctccttcgactttcggt
ggtatcggggatgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactctgttggggacaacgttagtgccatcaacctcttgaatatcaaaaaagtc
ggacgccggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattgaatacctacaaaaatgtcgtgacgttgaacgtgtcatgatcgttacagac
cacgctatggtagagcttggtttccttgatcgtatcatcgaacagcttgaccttcgtcgc
aacaaggtggtttaccaaatctttgcagacgtagaaccagatccagatatcacaaccgtt
gaacgtggtacagagatcatgcgtgccttcaaaccagataccatcgtcgctcttggtggt
ggatctccaatggatgcggctaaagtaatgtggctcttctatgaacaaccagaagtggac
ttccgtgaccttgtacaaaaattcatggatattcgtaaacgtgccttcaagttcccattg
cttggtaagaagaccaaatttatcgctatcccaacaacatctggtacaggatctgaagta
acgccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgcagactac
tcattgacgccaaccgttgccatcgtagaccctgccttggtattgacagttcctggattt
gtagctgctgatactggtatggacgtattgactcacgcgactgaagcttacgtatcacaa
atggcaagtgactacactgatggtcttgctcttcaagctattaaacttgtctttgaaaac
ttggaaagctcagtcaagaatgcggacttccattcacgtgaaaagatgcacaatgcgtca
acgatcgcaggtatggccttcgccaatgccttcctcggtatttctcactcaatggcccac
aagatcggtgcgcaattccacaccatccacggacggaccaatgcgatcttgcttccatac
gttatccgctacaacggtacacgcccagccaagacagctacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgctcgtatgctaggacttccatgttctact
ccagaagaagccgttgaagcttacgcaaaagctgtatacgaactcggtgaacgctgtggt
atcgaaatgaacttcaaagcacaaggaatcgatgaaaaagaatggaagaaacattctcgt
gaattggccttccttgcttacgaagatcaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcttactatggttacaaggaacgcccagga
cgtcgtaaataa

DBGET integrated database retrieval system