KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11529Help
Entry
HMPREF0833_11529  CDS       T01545                                 

Gene name
aad
Definition
aldehyde-alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0833_11529 (aad)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11529 (aad)
   00620 Pyruvate metabolism
    HMPREF0833_11529 (aad)
   00650 Butanoate metabolism
    HMPREF0833_11529 (aad)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0833_11529 (aad)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0833_11529 (aad)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0833_11529 (aad)
   00626 Naphthalene degradation
    HMPREF0833_11529 (aad)
Enzymes [BR:scp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0833_11529 (aad)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0833_11529 (aad)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1650279..1652930
Genome map
AA seq 883 aa AA seqDB search
MADKKTLSPEEKKLAAEKHVDELVQKALVALEEMRKLNQEQVDYIVAKASVAALDAHGEL
ALHAYEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVISEDDVTGLTLIAEPVGVVCG
ITPTTNPTSTAIFKALISLKTRNPIVFAFHPSAQESSAHAAQIVRDAAIAAGAPENCVQW
ITQPSMEATSALMNHEGVATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQ
AAHDIVMSKSFDNGMVCASEQAVIIDKEIYDEFVEEFKSYHTYFVNKKEKALLEEFCFGV
KANSKNCAGAKLNADIVGKPAAWIAEQAGFSVPEGTNILAAECKEVGEKEPLTREKLSPV
IAVLKSESREDGINKARQMVEFNGLGHSAAIHTADEELTKEFGKAVKAIRVICNSPSTFG
GIGDVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWMKLPSKTYFER
DSIEYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFADVEPDPDITTV
ERGTEIMRAFKPDTIVALGGGSPMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPL
LGKKTKFIAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVLTVPGF
VAADTGMDVLTHATEAYVSQMASDYTDGLALQAIKLVFENLESSVKNADFHSREKMHNAS
TIAGMAFANAFLGISHSMAHKIGAQFHTIHGRTNAILLPYVIRYNGTRPAKTATWPKYNY
YRADEKYQDIARMLGLPCSTPEEAVEAYAKAVYELGERCGIEMNFKAQGIDEKEWKKHSR
ELAFLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYKERPGRRK
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaaaaaactctctcacctgaagaaaagaaactcgctgctgaaaaacacgta
gacgagttggtgcaaaaagcgctggtggcgcttgaagaaatgcgcaaattgaatcaggaa
caagtggactacattgttgcgaaagcatctgtagctgctcttgacgcacacggtgaactc
gctcttcatgcatatgaagaaactggtcgtggggtctttgaagacaaagcgaccaagaac
ttgttcgcttgtgaacacgttgtgaataacatgcgtcacacgaagacagttggtgtcatt
tcagaagatgacgtcactggtttaacgctaattgctgagccagtcggagttgtctgcggg
atcactcctacaacaaaccctacttcaacagcaatctttaaagcattgatttccttgaag
acacggaaccctatcgtctttgccttccacccatctgctcaagaatcatcagctcatgcg
gcacaaatcgtacgcgatgcggcaattgcagctggagcacctgagaactgtgtgcaatgg
attacccaaccttctatggaagcaaccagtgcccttatgaaccatgaaggagttgctacg
atccttgcgaccggtgggaatgccatggtgaaagcggcatactcatgtgggaaaccagct
cttggggtcggtgccggaaacgtacctgcttatgttgaaaaatcagctaatatccgccaa
gcagcacacgatatcgtcatgtctaaatcatttgacaacggaatggtttgtgcgtctgaa
caagcggtcatcatcgataaagaaatctacgatgagtttgttgaagaattcaaatcttac
cacacttactttgttaacaaaaaagaaaaagcccttcttgaagagttctgcttcggcgta
aaagcgaacagcaagaactgtgcgggtgcgaaattgaatgcggacatcgttgggaaacca
gcagcatggatcgctgaacaagctggcttctcagtcccagaaggaaccaatatccttgct
gcagaatgtaaagaagttggtgaaaaagaaccgttgactcgtgaaaaattgtcaccagtc
atcgctgtcttgaaatctgaaagccgtgaagacggaattaacaaagctcgccaaatggtt
gaattcaacggtcttggtcactcagcagccatccatactgctgatgaagaattgaccaaa
gaatttggtaaagcagtcaaagctattcgtgttatctgcaactctccttcgactttcggt
ggtatcggggatgtttacaatgccttcttgccatcattgacacttggatgtggttcttac
ggacgcaactctgttggggacaacgttagtgccatcaacctcttgaatatcaaaaaagtc
ggacgccggagaaataacatgcaatggatgaaacttccttcaaaaacatactttgaacgt
gattcaattgaatacctacaaaaatgtcgtgacgttgaacgtgtcatgatcgttacagac
cacgctatggtagagcttggtttccttgatcgtatcatcgaacagcttgaccttcgtcgc
aacaaggtggtttaccaaatctttgcagacgtagaaccagatccagatatcacaaccgtt
gaacgtggtacagagatcatgcgtgccttcaaaccagataccatcgtcgctcttggtggt
ggatctccaatggatgcggctaaagtaatgtggctcttctatgaacaaccagaagtggac
ttccgtgaccttgtacaaaaattcatggatattcgtaaacgtgccttcaagttcccattg
cttggtaagaagaccaaatttatcgctatcccaacaacatctggtacaggatctgaagta
acgccatttgccgttatctctgataaagcaaacaaccgtaaatacccaatcgcagactac
tcattgacgccaaccgttgccatcgtagaccctgccttggtattgacagttcctggattt
gtagctgctgatactggtatggacgtattgactcacgcgactgaagcttacgtatcacaa
atggcaagtgactacactgatggtcttgctcttcaagctattaaacttgtctttgaaaac
ttggaaagctcagtcaagaatgcggacttccattcacgtgaaaagatgcacaatgcgtca
acgatcgcaggtatggccttcgccaatgccttcctcggtatttctcactcaatggcccac
aagatcggtgcgcaattccacaccatccacggacggaccaatgcgatcttgcttccatac
gttatccgctacaacggtacacgcccagccaagacagctacatggcctaagtacaactac
taccgtgcagatgaaaaataccaagatatcgctcgtatgctaggacttccatgttctact
ccagaagaagccgttgaagcttacgcaaaagctgtatacgaactcggtgaacgctgtggt
atcgaaatgaacttcaaagcacaaggaatcgatgaaaaagaatggaagaaacattctcgt
gaattggccttccttgcttacgaagatcaatgttcaccagctaacccacgtcttccaatg
gtagaccatatgcaagaaatcatcgaagatgcttactatggttacaaggaacgcccagga
cgtcgtaaataa

DBGET integrated database retrieval system