KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11570Help
Entry
HMPREF0833_11570  CDS       T01545                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0833_11570 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11570 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0833_11570 (thrC)
Enzymes [BR:scp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0833_11570 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1692181..1693665
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNTVTASQAILQGLATDGGLFTPVSYPQVELDFDTLKDASYQEVAKLVL
SAFLDDFTAEELDYCISHAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLATNKMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKTGQITAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNENNVLTD
FFKTHVYDKKREFKVTTSPSMDILVSSNLERLIFHLVGNDATKTKELMESLVATGQYQLS
NFDADILDLFAAAYADEAETAAEIKRVYEASDYIEDPHTAVASAVYQKYRTQTGDTAKTV
IASTASPYKFPVVAVEAVTGETGLGDFEALAKLHTLSGVPVPPAVDGLETAPVRHRTSVA
AKDMQAAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttaccaatcaacacgagatgaaaaaaatactgtaacagctagtcaagcc
atccttcaaggattggcgacagatggcggtttgtttaccccagtctcttatcctcaagta
gagctggattttgataccctcaaagacgcttcttaccaagaagtggccaagcttgttttg
tcagcctttttggacgactttacagcagaagagttggactactgtatttctcatgcttat
gacagcaagtttgatactccagctattgctcctcttgtcaaactcgatgggcagtacaac
ttggaactcttccatggttccaccattgcctttaaagatatggctttgtcgatcttgcct
tactttatgacaacagcagctaaaaagcacggtttggaaaataaaattgtcatcttgacg
gcgacttctggagatacaggaaaagctgctatggcaggttttgccgatgttccagggaca
gagatcattgtcttttatccaaaagatggtgtcagcaaggtgcaagaattgcaaatgacg
actcaaacgggggacaatacccatgtcatcgcgatcgatggaaactttgacgatgcccaa
accaatgtcaaacacatgttcaatgatgtggcgcttcgtgaaaaattagcaaccaacaag
atgcaattctcatcagccaactctatgaacattggtcgtttggtgcctcaggttgtctat
tacgtatacgcctatgcgcaattggtgaagacaggccaaatcacagcgggagaaaaagtc
aactttaccgtcccaacaggaaactttggaaatatcttagcagctttctatgccaaacaa
atcggtcttccagttggaaaattgatctgtgcgtcaaatgaaaacaatgtcttgacagac
ttcttcaaaacacatgtctatgataagaaacgtgagttcaaggtgaccactagcccatca
atggatattttagtctcttcaaacttggaacgcttgattttccacttggtaggcaatgat
gccacaaagaccaaagaattgatggaaagcctcgttgcaacaggtcagtaccaattgtcc
aactttgatgcagacatcttagatttgtttgcggctgcatacgcagatgaagcagaaact
gctgcagagatcaagcgggtttatgaagcgtctgattacatcgaagaccctcatacagcc
gtagcatcagccgtttatcaaaaataccggacccaaacaggggatactgctaaaacagtt
attgcctctacagcaagtccttacaaattcccagttgtagcagtagaagcggtgacaggc
gagacaggtctaggcgatttcgaagccttggctaaattacacacactctcaggtgttcct
gtgccaccggctgtagacggccttgaaactgcaccggttcgccatcgtacaagcgtggca
gccaaagacatgcaagcagccgtagaagactacttgggactttaa

DBGET integrated database retrieval system