KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11570Help
Entry
HMPREF0833_11570  CDS       T01545                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00260  Glycine, serine and threonine metabolism
scp00750  Vitamin B6 metabolism
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01120  Microbial metabolism in diverse environments
scp01230  Biosynthesis of amino acids
Module
scp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11570 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0833_11570 (thrC)
Enzymes [BR:scp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0833_11570 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N Ferritin DUF4252
Motif
Other DBs
NCBI-ProteinID: AEH56601
UniProt: F8DGC0
Position
1692181..1693665
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDEKNTVTASQAILQGLATDGGLFTPVSYPQVELDFDTLKDASYQEVAKLVL
SAFLDDFTAEELDYCISHAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKVQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALREKLATNKMQFSSANSMNIGRLVPQVVY
YVYAYAQLVKTGQITAGEKVNFTVPTGNFGNILAAFYAKQIGLPVGKLICASNENNVLTD
FFKTHVYDKKREFKVTTSPSMDILVSSNLERLIFHLVGNDATKTKELMESLVATGQYQLS
NFDADILDLFAAAYADEAETAAEIKRVYEASDYIEDPHTAVASAVYQKYRTQTGDTAKTV
IASTASPYKFPVVAVEAVTGETGLGDFEALAKLHTLSGVPVPPAVDGLETAPVRHRTSVA
AKDMQAAVEDYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttaccaatcaacacgagatgaaaaaaatactgtaacagctagtcaagcc
atccttcaaggattggcgacagatggcggtttgtttaccccagtctcttatcctcaagta
gagctggattttgataccctcaaagacgcttcttaccaagaagtggccaagcttgttttg
tcagcctttttggacgactttacagcagaagagttggactactgtatttctcatgcttat
gacagcaagtttgatactccagctattgctcctcttgtcaaactcgatgggcagtacaac
ttggaactcttccatggttccaccattgcctttaaagatatggctttgtcgatcttgcct
tactttatgacaacagcagctaaaaagcacggtttggaaaataaaattgtcatcttgacg
gcgacttctggagatacaggaaaagctgctatggcaggttttgccgatgttccagggaca
gagatcattgtcttttatccaaaagatggtgtcagcaaggtgcaagaattgcaaatgacg
actcaaacgggggacaatacccatgtcatcgcgatcgatggaaactttgacgatgcccaa
accaatgtcaaacacatgttcaatgatgtggcgcttcgtgaaaaattagcaaccaacaag
atgcaattctcatcagccaactctatgaacattggtcgtttggtgcctcaggttgtctat
tacgtatacgcctatgcgcaattggtgaagacaggccaaatcacagcgggagaaaaagtc
aactttaccgtcccaacaggaaactttggaaatatcttagcagctttctatgccaaacaa
atcggtcttccagttggaaaattgatctgtgcgtcaaatgaaaacaatgtcttgacagac
ttcttcaaaacacatgtctatgataagaaacgtgagttcaaggtgaccactagcccatca
atggatattttagtctcttcaaacttggaacgcttgattttccacttggtaggcaatgat
gccacaaagaccaaagaattgatggaaagcctcgttgcaacaggtcagtaccaattgtcc
aactttgatgcagacatcttagatttgtttgcggctgcatacgcagatgaagcagaaact
gctgcagagatcaagcgggtttatgaagcgtctgattacatcgaagaccctcatacagcc
gtagcatcagccgtttatcaaaaataccggacccaaacaggggatactgctaaaacagtt
attgcctctacagcaagtccttacaaattcccagttgtagcagtagaagcggtgacaggc
gagacaggtctaggcgatttcgaagccttggctaaattacacacactctcaggtgttcct
gtgccaccggctgtagacggccttgaaactgcaccggttcgccatcgtacaagcgtggca
gccaaagacatgcaagcagccgtagaagactacttgggactttaa

DBGET integrated database retrieval system