KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11579Help
Entry
HMPREF0833_11579  CDS       T01545                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
scp00260  Glycine, serine and threonine metabolism
scp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
scp01100  Metabolic pathways
scp01110  Biosynthesis of secondary metabolites
scp01130  Biosynthesis of antibiotics
scp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11579 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0833_11579 (trpB)
Enzymes [BR:scp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0833_11579 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEH56610
UniProt: F8DGC7
Position
1701469..1702674
Genome map
AA seq 401 aa AA seqDB search
MAYKQPDKNGFYGRFGGRFVPETLMTAVLELEEAYRESQADPSFQAELDQLLKQYVGRET
PLYYAKNLTKYVGGAKIFLKREDLNHTGAHKINNALGQVLLAHRMGKKKIIAETGAGQHG
VATATAAALFDMECTIYMGEEDVKRQALNVFRMELLGAKVQSVTDGSRVLKDAVNAALRA
WVANVEDTHYIMGSALGPHPFPEIVRDFQSVIGREAKRQFAEQNDGALPDAVLACVGGGS
NAIGLFYPFVEDTSVAMYGAEAAGLGVDTDQHAATLTKGRPGVLHGALMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSYFHDIKRATYVPVTDKEALEAFQLLSKVEGIIPALESSHAI
AYAVKLAKEMGPEKSMIVCLSGRGDKDVVQVKDRLEQERGE
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcatataaacaaccagataaaaacggattttacgggcggttcgggggacgatttgtc
cctgaaaccttgatgacagcagttttagaattagaagaagcctatagagaaagtcaagca
gatccttcttttcaagcagaattggatcagcttctgaaacaatatgtcggtcgggaaaca
ccgctctattacgctaagaatctaaccaagtatgttggtggagccaagatttttcttaaa
agagaagacctcaaccacacaggggctcataaaattaataatgccctaggacaggtttta
ttggcacatcggatgggcaaaaagaagatcatcgcagaaacaggggctggacagcacggt
gttgcaactgcaacggctgctgctttatttgatatggaatgcaccatctacatgggggaa
gaagatgtcaaacgccaagccctcaatgtctttcggatggaattgttgggcgccaaggtt
caatcagtaacagatgggtcgcgtgtcctcaaggatgcggtcaatgctgctcttagagct
tgggtagcaaatgtggaggatacccactatatcatgggatctgctctaggacctcaccca
ttcccagagattgtccgtgattttcaaagtgtcatcggtagagaagccaaacgccaattt
gcagagcaaaatgacggggcgctgccagatgccgtcctagcctgtgtaggaggtggatcg
aacgctattgggctcttttatccttttgttgaggatacatctgttgccatgtatggggca
gaagctgctgggcttggagtggatacagaccagcatgcagcaaccttgaccaagggacgt
ccgggagtccttcacggcgccttgatggatgttttacaggatgcccatggacagatttta
gaagccttttcgatttcagcaggtctcgattatcctgggattgggccagagcattcttat
ttccatgacatcaagcgggcaacctatgtgcctgtgacagacaaagaagccctagaagcc
tttcaattgctttcgaaagtagaaggaatcattccagctctggaatcgagccatgctatc
gcctatgcggtgaaattggctaaggagatggggcctgaaaaatccatgatcgtttgctta
tcaggtcgtggggacaaagatgtggtacaagtcaaagaccgcctagaacaagagagagga
gagtaa

DBGET integrated database retrieval system