KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11580Help
Entry
HMPREF0833_11580  CDS       T01545                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0833_11580 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11580 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0833_11580 (trpA)
Enzymes [BR:scp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0833_11580 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1702676..1703452
Genome map
AA seq 258 aa AA seqDB search
MGKTLTDHLQKLKDQQQGIFVPYIMAGDHEKGLAGLQETIQFLEGLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTTTEELVQTIQRLETSVPLVIMTYFNPLFQYGLENFFRDVEG
TAVKGVIIPDLPHEHADLVEPLLADKDIALVPLVSLTTGIERQKKLIQDAEGFIYAVAVN
GVTGKAGSYRDDLDHHLAQLHEIASIPVLTGFGVSSMEDVHRFNKVSDGVIVGSKIVKAL
HQGETDAIARFISQAVKG
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaccttaacagatcatttacaaaagttgaaagaccagcagcaagggatcttt
gttccttatattatggcaggagatcatgaaaaaggcttggcaggtttgcaggaaaccatc
caatttttagaggggcttggtgtctcagcgattgaggttggcattcctttttcggatccg
gtggcagatggtcctgtgattgaagaggcaggattacgcagtttagcccatgggacgacg
acagaggaactggtgcaaacgatccagcgtctggagacaagtgttcctttggtcatcatg
acctatttcaatcccttgttccaatatggtctagaaaacttttttagagatgtagaagga
acagcagtcaaaggagtgattattcccgatcttcctcatgagcatgcggatctggtagag
cctctattagcggataaagacatcgccttggtgccactagtgagcttaaccacaggaatc
gagcgccaaaagaaattgatccaagatgcagaaggatttatctatgccgttgctgtcaat
ggagtgacggggaaagctggtagctatcgagatgatttggatcaccacttggcccaatta
cacgaaatagcatccattcctgttttaacaggttttggagtttccagcatggaggatgtt
caccgtttcaacaaggtctcagatggggttattgtggggtctaaaatcgttaaggctctc
caccaaggggagacagacgccatcgctcgttttatttctcaagcagtgaagggctag

DBGET integrated database retrieval system