KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11585Help
Entry
HMPREF0833_11585  CDS       T01545                                 

Gene name
tgt
Definition
tRNA-guanine transglycosylase (EC:2.4.2.29)
Orthology
K00773  
queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Brite
Enzymes [BR:scp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     HMPREF0833_11585 (tgt)
Transfer RNA biogenesis [BR:scp03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    HMPREF0833_11585 (tgt)
 Prokaryotic Type
    HMPREF0833_11585 (tgt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1709624..1710766
Genome map
AA seq 380 aa AA seqDB search
MTDSPIQYRLIKKEKHTGARLGEIITPHGTFPTPMFMPVGTQATVKTQSPEELKEMGSGI
ILANTYHLWLRPGDDLVAKAGGLHQFMNWDQPILTDSGGFQVYSLADTRNITEEGVTFKN
HLNGSKMFLSPEKAISIQNNLGSDIMMSFDECPQFYQPYDYVKKSIERTSRWAERGLKAH
RRPHDQGLFGIVQGAGFEDLRRQSAQDLVSMDFPGYSIGGLAVGESHEEMNAVLDFTTPL
LPENKPRYLMGVGAPDSLIDGVIRGVDMFDCVLPTRIARNGTCMTSQGRLVVKNAQFAED
FTPLDPECDCYTCKNYTRAYLRHLLKADETFGIRLTSYHNLYFLINLMKQVRQAIMDDNL
LEFREHFVEKYGYNKSGRNF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagattcaccgattcaatatcgattaatcaaaaaagaaaagcatacaggtgctcgt
ctgggagaaattattacccctcacgggaccttcccgaccccaatgtttatgcctgtaggg
actcaggcaaccgttaagacccaatcgccagaagaactcaaggaaatgggttccggaatt
atcttggccaacacctaccatctctggcttcgtccgggggacgacttggtcgcaaaagca
ggaggactgcaccagttcatgaactgggaccagcccattttgacagatagtggaggcttt
caggtctattcattggcggatacccgcaacatcaccgaagaaggggtaacctttaaaaat
cacctcaacggctcgaagatgttcctctctccagaaaaggccatctccatccaaaacaat
ctaggaagcgacatcatgatgtcctttgatgaatgccctcagttctatcagccttatgat
tatgtgaaaaaatcgatcgaacggaccagtcgttgggcagaacgtgggcttaaggctcac
cgtcgccctcatgatcaaggtcttttcgggattgtccaaggggctggatttgaagacttg
cgccgtcagtctgctcaagatctggtcagcatggacttcccaggctattctatcggtggc
ttagctgttggggaaagccatgaagagatgaatgccgtgctggatttcacaactccactc
ttaccagagaacaagccacgctatctcatgggagtaggagctccagacagtctgatcgat
ggcgttattcgtggagtggacatgtttgactgtgtcttgccgacgcggattgcgcgaaat
ggtacctgtatgaccagccaaggacgcctagtggtgaaaaatgcgcaatttgcagaagac
tttacaccgctggatcctgaatgtgattgctacacttgtaagaattacacccgagcttat
cttcgccacctcctcaaggcagatgaaaccttcggcattcgcttgaccagctaccacaac
ctgtacttcttgatcaacctcatgaagcaggtccgtcaagccatcatggatgacaatctt
ttagaattccgtgagcatttcgtcgaaaaatatggctataataaatcaggacggaatttc
tag

DBGET integrated database retrieval system