KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11667Help
Entry
HMPREF0833_11667  CDS       T01545                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:scp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791409..1791963
Genome map
AA seq 184 aa AA seqDB search
MDTKKIEEAVKMIIEAVGEDENREGLQETPTRIAKMYQEIFAGLGQTAEEHLSKSFEIID
NNMVVEKDIFFHSMCEHHFLPFYGKVHIAYIPNGRVAGLSKLARTVEVYAKKPQIQERLT
VEIADALMEYLGAQGALVWVEAEHMCMNMRGVRKPGTATVTTAARGVLATNKDLKNEAYK
LMGH
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacaaagaaaattgaagaagcagtgaaaatgatcatcgaggcagtcggtgaagat
gagaaccgtgagggccttcaggaaacgccgacccgcattgccaagatgtaccaagaaatc
tttgcgggactagggcagacagcagaagagcacctgtctaaatcatttgaaatcattgat
aacaatatggtggtcgagaaggatatcttcttccattccatgtgtgagcatcacttttta
ccattttatggaaaagtgcacattgcctacattccaaatggccgtgtggctgggctttca
aaactggctcgtacggtcgaggtttatgctaaaaaaccacagattcaggaacgtttgacg
gtagaaatcgcagatgccttgatggaatatcttggagcacaaggagcacttgtctgggta
gaagcagagcatatgtgtatgaacatgcgtggtgtccgtaaacctgggaccgctacagtg
acaactgcagcgcgtggagtgcttgcgacaaataaagacttaaaaaatgaagcctataaa
ctcatgggccactaa

DBGET integrated database retrieval system