KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11668Help
Entry
HMPREF0833_11668  CDS       T01545                                 

Gene name
sulD
Definition
bifunctional folate synthesis protein (EC:2.7.6.3 4.1.2.25)
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    HMPREF0833_11668 (sulD)
Enzymes [BR:scp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     HMPREF0833_11668 (sulD)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.25  dihydroneopterin aldolase
     HMPREF0833_11668 (sulD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791989..1792798
Genome map
AA seq 269 aa AA seqDB search
MDQLRIKDLEVYAYHGVFPAEKELGQRFVLDLWVDYEMTRAARTGDLEASIHYGILAEQL
TEWMQAEKIDLIETVAFQLVQKIFESYAFVEKVRLELKKPWAPVPLPLETCSVTIEREKK
RAFIGLGTNMGDKQLQLETALEKIKDRGIRLLQTSTRIETEPWGGVEQDTFLNQVAEVET
WMTPEDLLETLLAIEQEMGRVREVKWGPRVIDLDLLYMDDTICYSPSLILPHPYVAERAF
VLESLNEIAPHFVDPVQRKPIRQLWEAVK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtggatcaattacggatcaaggacttagaggtatacgcctatcacggtgtttttccggca
gaaaaagaattaggacaacgctttgtcctagacctatgggtagattatgagatgactcgt
gctgcccgcacaggtgatttggaagcttcgattcattatgggatcttggcggaacagttg
accgagtggatgcaggcagaaaaaatcgatctgattgaaacggtggcctttcagttggtt
caaaagattttcgaaagctatgcctttgtagaaaaagttcgtctggagttgaaaaagcca
tgggctcctgttcccttgccattagagacttgttcggtgacaatcgaacgggagaaaaaa
cgggcctttattgggcttggcaccaatatgggagataaacaactgcaactagagacggcg
ctagaaaaaatcaaggatcgaggcattcgccttcttcagacatccacaaggattgaaaca
gaaccttggggaggagtggagcaggacacctttttgaatcaagtggcagaggttgaaacc
tggatgaccccagaggatttactagagaccttacttgccattgagcaggaaatggggcgt
gtccgtgaggtcaagtgggggccgcgtgtgatcgatctagatctgctctatatggatgac
accatttgttacagtccgagcttgatcttgccacatccttatgtggcagaacgtgccttt
gtcctagagtctttgaatgaaattgctcctcattttgtggaccctgttcaaagaaagccc
attcgccaattatgggaggctgtcaaatag

DBGET integrated database retrieval system