KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11731Help
Entry
HMPREF0833_11731  CDS       T01545                                 

Gene name
bgl
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11731 (bgl)
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     HMPREF0833_11731 (bgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1853874..1855259
Genome map
AA seq 461 aa AA seqDB search
MYQFPKDFLWGSSTSGPQTEGRFAQDGKGDNLWDYWYRIEPNRFYQGQGPEKTSTFYEHW
EEDLDLLLETGHTAFRTSIQWSRIFPEGRGEINQAGVDFYRRVFEKIKEKGIHLLVNLYH
FDLPMALQEQGDGWENKETAYAYQEYTRFCFKTYGDLVDQWITFNEPIVPVEFGYFYDAH
FPHKVDAAAAVKVAYHTQLASSLAVKACHEVDPNFRIGIVLNLTPAYPRSQHPEDVKAAR
IAELFQAKSFLDPSVLGHYPEELVEILRERDLLPDYDPFELRLIEENTVDYLGVNYYQPL
RVAAPRYAPNPASPLLFEQFYEPYVMPGRKINPHRGWEIYEQGLYDIAQNIKENYGNIEW
ILTENGMGVEGEEKFRKDGVIQDDYRIDFVKDHLRELHRAIQDGANCKGYLIWTFIDCWS
WLNGYKNRYGLVELDLESQKRTLKKSGHWFKELSQANGFEK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaatttccaaaggattttttatgggggagttcgacctcgggccctcaaacagaa
gggcgtttcgcccaagatggaaagggagacaatctctgggattactggtataggatcgag
cccaaccgcttttatcaagggcaaggaccagagaaaacatcgactttttatgaacactgg
gaagaagatctggacctcttgttagaaactgggcacaccgcctttcgaacctctattcag
tggtcccgtattttcccagaaggacgaggggagatcaatcaagcaggcgttgatttctac
cgtcgtgtctttgaaaagataaaggaaaaagggattcacctcttggtcaacctctatcat
tttgatttaccgatggctcttcaagagcaaggggatggttgggaaaataaagaaaccgcc
tatgcttaccaagaatatacgcgtttttgtttcaagacctatggagatctggtcgatcag
tggatcacctttaatgaacccattgtccctgtggagtttggttatttttatgatgcccat
tttcctcataaggtagatgcagcagcagcagtaaaagtagcctaccacacccagttagca
agctctctagcagtgaaggcctgtcacgaggtggatcctaatttccgtatcggaattgtg
ctcaatttgacaccagcctatcctcggagccagcatccagaagatgtgaaagccgcgcgc
attgccgagctctttcaagccaaatccttcttagatccatctgttcttggtcattatcct
gaagaattagtggagatcctacgagagcgtgatctcttaccggattatgatccctttgaa
ttgcgcttgatcgaggaaaatacggtggattacctaggagttaactattaccaaccactc
cgtgtggcggctcctcgttatgctccaaatccagcatctcccctactctttgaacaattt
tatgaaccctatgttatgccaggccgcaagatcaatccccaccgtggttgggaaatctat
gagcaaggtttgtatgacattgcccaaaatatcaaggaaaactatggcaatatcgagtgg
atcctgacagaaaatggaatgggggttgaaggagaggaaaaattccgcaaggacggagtg
atccaagacgactaccggattgactttgtcaaagaccatcttcgtgagctccaccgggct
attcaagatggtgccaactgtaaaggctatttgatctggacctttattgactgctggtca
tggctcaatggctacaagaaccgctatggtttagttgagttggacctcgaaagtcaaaaa
cgaaccctcaaaaaatccggtcattggtttaaagaactaagccaagccaatggatttgag
aagtag

DBGET integrated database retrieval system