KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11884Help
Entry
HMPREF0833_11884  CDS       T01545                                 

Gene name
nagZ2
Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0833_11884 (nagZ2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    HMPREF0833_11884 (nagZ2)
Enzymes [BR:scp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     HMPREF0833_11884 (nagZ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2004655..2008194
Genome map
AA seq 1179 aa AA seqDB search
MKSHQPRYAIRKYAVGAASVLIGFFAGAHVVAADTPTTTESPATTVPTQPNESESTISLN
EEASQPAVEKPTAPAPIVDQSQPTLPDRELRVSDLDRLIREEASSVAESDVTTQPTTAAT
ETPAKDPDQEEKLAKKKIVSIDAGRKYFSPDQIKEIIDEASKTGYTDLHLLVGNDGLRFV
LDDMSLKVGDTSYSSQAVTDAVEKGTKAYYDDPNGTALTQAQMDDILAYAKSKKVGVIPT
INSPGHMDAILTAMEQLGIENPHFNYFGTKKSARTVDLDNQKALDFTKALVDKYAAYFSG
KADIFNIGLDEYANDATDDHGWQVLQASKHWPGEGYPEKGYEKFIQYANDLAAIVKKHKM
KPMAFNDGIYYNGDTSYGTFDKDIIVSYWTGGWNGYDVASSKLLSELGHQILNTNDAWYY
VIGRDKAGSGWYNLDQGLEGISKSAIDVVQKNDGSKVPFIGGMVAAWADTPSATYKKDLL
FKLMHAFVDKNADYFVADLEVVEKALSEAPTDLDHYTPESLVAFTAAKKALEGVGADTTR
AEAKTLIDHLKAAQDALVYTESYAKEVAAKEAAEKLAMKKVISIDAGRKYFSLDQLKRIV
DKASELGYSDLHLLVGNDGMRFVLDDMTVEANGKTYASDDVKKAILEGTKAYYDDPNGQA
LTQAEMDELHAYATAKGIGLIAAVNSPGHMDALLVAMEKLGIENPQASFDTVSKTTMDLT
NEAAVNFTKALIGKYMDYFKDKSKIFNYGTDEYANDATSAQGWYYLKWYDLYGKFAEYSN
SLAAMAREKGLQPMAFNDGFYYGDEDDVAFDKDVLISYWSKGWWGYNLASPQYLADKGYK
FLNTNGDWYYVLGRTPETGGGYIEKAIANAAATPFRQLPSTTYPETSLPMIGSMVAVWCD
TPSEEYIEKNVFDLMEAFANHNKDYFKADFTALRKAVATVPTDLDIYTPESRAALAKVLD
SLNWNVSRAHQDQVDQEVATLTQALAGLKPITQVGSLAENDVKALVEDKPSLEIVEKELD
FDLVERSNPDLAKGERKVIQAGVKGQGLEYVEVSALDQSRKVIATEVATEPVAEIVEVGT
KEVVIPTTPSVEAPVKSDVLVNKVVPDPSTPQVISKDQPVAPGNTPTPIPAAVEKEVRSE
TVSSNKQLPETGAESALGLALLGAILGAAGMDLKNKKRD
NT seq 3540 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacatcaaccacgttatgcgattcgcaagtatgcagtaggagctgcttcggtg
ctcataggattttttgctggtgctcatgttgtagcggccgatacgccgacgactactgaa
agtcctgcaacgacagttccaactcagccaaacgagagtgagtcaactatttcccttaat
gaggaagcttctcagccagcagtagaaaaaccaacggctcctgccccgatcgtcgatcaa
agtcaaccaacactgcctgatcgtgaattgcgggtatcagatcttgaccgtttgattcgc
gaagaagcaagttctgtcgcagagtcggatgtgacaactcaaccaacgacagcagcgacg
gaaacgcctgctaaagatcctgaccaagaagaaaaattagccaagaaaaagattgtttcg
attgatgccggtcgcaagtacttctcaccagaccaaatcaaggaaatcattgatgaagca
agtaagacgggctatacagacttgcatcttctagttggaaatgacggcttgcgctttgtg
ctggatgatatgtctttgaaagtgggagatacttcttattctagccaagccgtgacagat
gctgttgaaaaagggacgaaggcttattacgatgatccgaacgggacagccttgacccag
gctcaaatggatgatattttggcctacgccaaatcgaagaaagtaggtgtcattccaacc
attaatagtccaggtcacatggatgcgattctgacagccatggaacaattggggatcgaa
aaccctcactttaattattttggtacaaagaaatcagctaggacagttgatttggacaac
caaaaagccttagactttactaaggctttggtagacaagtatgcggcttatttcagcggc
aaagcagatattttcaatattggtttggatgaatatgccaacgatgccacagatgaccat
ggttggcaggttctccaagccagcaagcattggccaggtgaaggctatccagaaaaaggc
tatgaaaaattcatccaatatgctaatgatctagcagctattgtgaaaaaacacaagatg
aaaccaatggcctttaatgacgggatctactacaatggcgatacttcctatggtactttt
gacaaggatatcattgtctcctactggacaggtggctggaatggctatgatgtcgcttct
tcaaaactcttgtctgaactaggtcatcagattcttaatactaatgatgcttggtattat
gtgattggacgggataaggctggatctggttggtacaaccttgatcaaggtctcgaagga
atttccaagtcagcgattgatgtcgttcaaaaaaatgatgggtctaaggtgcccttcatc
ggtgggatggtagctgcctgggcagatacaccatccgcaacctacaaaaaagaccttctc
tttaagttgatgcatgccttcgtggacaagaatgcggactactttgttgcagatcttgaa
gttgtcgaaaaagctctttcggaagctccaactgatttggatcactatacaccggaatct
ctagtagcctttacggcagccaaaaaagctttagaaggggtaggagcagacacgactcga
gcagaggccaaaaccttgatcgatcatcttaaagcggctcaagatgctttggtgtataca
gaaagctacgcgaaagaagttgctgcaaaagaagcagcagaaaaactcgccatgaagaag
gtcatctcgatcgatgcaggtcgcaaatacttctcgctggatcagttgaaacggatcgta
gataaggccagtgagctgggttattctgacttgcacctccttgtcggaaacgatggtatg
cgcttcgtcctcgatgatatgacggtggaagccaatggcaaaacctatgccagtgacgat
gtgaaaaaggccattctagaaggcaccaaggcctattacgatgatccaaatggtcaagct
ttgacccaagcagaaatggatgagctccatgcttatgctactgctaaaggaatcggcttg
attgcggcagtcaatagtcctggccacatggatgctttgttggtggccatggaaaaattg
ggcattgaaaatccacaagccagctttgatacggtttcaaaaacaaccatggatttgacc
aatgaagcagcagtcaactttaccaaagccttgattggcaagtatatggactacttcaaa
gacaagtctaagatctttaactacggaacagatgaatatgccaatgacgctaccagtgcg
caaggttggtactacctcaagtggtatgacctctatggtaagtttgcggagtattccaat
agtcttgcagccatggcgcgtgaaaaaggcttgcagccaatggcctttaacgatggcttc
tattatggagatgaagatgatgttgcctttgacaaggacgtcttgatttcatactggtct
aaaggatggtggggctataacctcgcatctccacagtatttggcagataagggttataaa
ttccttaataccaacggagactggtattatgttttgggaagaacacctgaaacgggtggt
ggttatattgagaaagcgattgccaatgcagctgctactccatttagacaactcccaagt
acaacgtatcctgaaacatctttgccgatgatcggtagtatggtagctgtttggtgtgat
accccaagtgaagaatacatcgaaaaaaatgtctttgatctcatggaagcttttgccaac
cataacaaggactatttcaaggcggacttcactgctcttagaaaagcagttgctacggtg
ccaacagatctagacatttacacaccagaatcgcgcgcagcccttgcgaaagtcttagat
agcttgaattggaatgtgagccgtgctcatcaagatcaggtggatcaagaagtggccact
ctgactcaagcccttgcggggctcaagccaatcacgcaagtaggtagcttggctgaaaat
gacgtcaaagccctagtggaagacaaaccaagtcttgaaatcgtagaaaaagaacttgat
tttgaccttgtggaacggagcaatccagatctcgctaaaggagaacgaaaagtgatccag
gctggggttaaagggcaaggtcttgagtatgtagaggtttcggcacttgatcaaagtcga
aaagtgattgctacagaagttgccacagagccggttgcagaaattgttgaagtcggtacc
aaagaagtcgtgatcccaacaaccccttccgtagaagcgccagtgaagtcagacgtgctc
gtaaacaaagtggttccagatccttcaacacctcaagtgatctcgaaagatcaaccagtt
gcaccaggaaataccccaacgccaattccagcagctgtggaaaaagaggttcgttcagaa
acagtatcttctaacaagcaacttccagaaacaggagcagaatctgctttgggactcgct
ttactaggagcgatcttaggggcagcaggaatggacttgaaaaataaaaaaagagactaa

DBGET integrated database retrieval system