KEGG   Streptococcus parasanguinis ATCC 15912: HMPREF0833_11895Help
Entry
HMPREF0833_11895  CDS       T01545                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
scp  Streptococcus parasanguinis ATCC 15912
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:scp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0833_11895
   01230 Biosynthesis of amino acids
    HMPREF0833_11895
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0833_11895
  Energy metabolism
   00680 Methane metabolism
    HMPREF0833_11895
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0833_11895
Enzymes [BR:scp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     HMPREF0833_11895
Exosome [BR:scp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   HMPREF0833_11895
  Exosomal proteins of melanoma cells
   HMPREF0833_11895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2018413..2018967
Genome map
AA seq 184 aa AA seqDB search
MNNSYILLRHAHSRFSSDDFNRTLSEKGFSSLNQLDFLNSFNIGYYFSSPYKRAFETINS
SPIQFDKIVLDNRLRERKLSSRFIEDTEFEKTIQYLWQNPDKSLIGGESNREALNRILDL
FEDLEERYSDKTILLSSHGNLLGILINHFDSSFDYKKWGQMTFPDCFLVDKDKSVKRIMK
VTSR
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcttatattttacttagacatgctcattcaagattttcaagtgatgatttt
aatagaactttgtcagaaaaaggattttcatctcttaatcagttagattttttgaattct
tttaatattggttattatttttctagtccttataaacgagcatttgaaacgattaatagc
tcgccaattcaatttgataaaatagttcttgataatcggttacgagagcgaaaattatcc
tcaagatttattgaagatactgagtttgaaaaaacaattcaatatttatggcaaaatcca
gataaatctcttattggaggcgagtccaatcgagaagcattaaatagaattttagattta
tttgaggacttggaagaaaggtattcagataaaaccattttactgagttctcatggaaat
ttgctaggaatcttaatcaatcattttgattcaagttttgattataaaaaatggggacag
atgacttttccagattgctttctagttgacaaagataagagtgtgaaaagaattatgaaa
gttacatctaggtaa

DBGET integrated database retrieval system