KEGG   Spiroplasma chrysopicola: SCHRY_v1c00330Help
Entry
SCHRY_v1c00330    CDS       T02676                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
scr  Spiroplasma chrysopicola
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:scr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCHRY_v1c00330 (tdk)
Enzymes [BR:scr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SCHRY_v1c00330 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
42932..43516
Genome map
AA seq 194 aa AA seqDB search
MYFLNSKAKLGWIEVITGCMFAGKTEEFIRRVVRLSYAKYKIQIFKPSIDNRYAEQKVVS
HSEKAIDAIPVLDSAQLLTKIDPDTLVVGIDEVQFFDQDIVETIDSLANRGIIVIVNGLD
KDFRGEPFLNVERLMSRAEEVKKLHAICVQCGNLANRTQRLINGQPANYYDPIVLIGEKD
KYEARCRHCHEVTY
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtattttttaaatagtaaggcaaaattagggtgaattgaagttattactggttgtatg
tttgccgggaaaacggaagaatttattcgaagagttgtccgtttgagttatgcaaaatat
aagattcagatttttaaaccaagtattgataatcgctatgctgaacaaaaagttgttagt
catagtgaaaaagcaattgatgcaataccagttttagattcggcacagttattaacaaaa
attgatccagatactttagttgttggaattgatgaggtccaattctttgaccaagatatt
gttgaaacaattgattcgttagctaatcgcggtattattgtcattgttaatggtttggat
aaagattttcgtggtgaaccatttctaaatgttgaaagattaatgagccgggctgaagaa
gtgaaaaaattacatgcaatttgtgttcaatgtggaaacttagccaatcggacacaacgg
ttaattaatggacaaccagcaaattattatgatccaattgttttaattggggaaaaagat
aaatatgaggcacgatgccgtcattgtcatgaagtgacatattaa

DBGET integrated database retrieval system