KEGG   Spiroplasma chrysopicola: SCHRY_v1c06700Help
Entry
SCHRY_v1c06700    CDS       T02676                                 

Gene name
adhE
Definition
(RefSeq) acetaldehyde dehydrogenase / alcohol dehydrogenase
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
scr  Spiroplasma chrysopicola
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:scr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SCHRY_v1c06700 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCHRY_v1c06700 (adhE)
   00620 Pyruvate metabolism
    SCHRY_v1c06700 (adhE)
   00650 Butanoate metabolism
    SCHRY_v1c06700 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SCHRY_v1c06700 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SCHRY_v1c06700 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCHRY_v1c06700 (adhE)
   00626 Naphthalene degradation
    SCHRY_v1c06700 (adhE)
Enzymes [BR:scr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SCHRY_v1c06700 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SCHRY_v1c06700 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(738490..741126)
Genome map
AA seq 878 aa AA seqDB search
MNNEKITKLIEKVQAAQSQFATFSQGQVDKIFTAVAIAANKARIELAIDAVNETNMGVIE
DKIIKNHYAAEYIHQKYLHTQTVGVVNENLGLGFQTVYEPVGVIGAIIPTTNPTATVIFK
IMLALKTRNGIIISPHPGAKNCTIKTAKILLAAAVKAGAPNNIIGWIDDAKVEDTIALMQ
EANLILATGGPGMVKSAYSSGKPAIGVGAGNCPAIISSLADLDMATSSIIQSNMFDNGVV
CATENSVIVLDSVYDQVCQYFTAKNGYIVTKKEDLDKIRAVMFKKDNYGILNAALVGKSP
LQIAEVAGITIPHQTKLILCEANKTTHDEPLAHEKLSTYVALYRAKDFNSAIKMASDLLL
MGPGHTASLWTDEIRGKQEIAKFRDELNAGRLLVNMPASLGAVGDMFNFYLAPSFTLGCG
SWGGNSTSENIQPKHLLNTKVLALRRENMEWIRLPEKIYHKFGCLPFALEDLKNWQAKKV
FIVTDPVINKLYSHKITTVLENLKINYDIFDSVEPNPTFATTKRGAAAMAISQPDVVIAI
GGGSAMDAAKIILLLHQDPNLNFENLAMTFNDIRKRIVKFPIINNQVKLVCIPTTAGTGS
EVTPFSVITDEKTHIKYPLADYALTPNIAIIDPELTLTLPKQATNAPALDALTHLFEAYV
SVLATTYTDPYCLQGIKTIFDFLPDAYHHGSDDIAARCAIADAATQAGMAFANAFLGLVH
SMSHKIGGKFNVIHGCANAILLPYVIRYNSAVILDGGKQTYFSQYKVANALERYATIARN
CEVKGKTPSELVDNLIIKIQNLVKNVEMPLSFKEYFAQYNLKVSEDEFLAAVDPMAQDAF
DDQCTPANPRIPLIKDIKAIYLDAYYGKPVKSLQSKND
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgaaaaaataactaaattaattgaaaaagtccaagcagcccaaagtcaattt
gctacttttagccaaggacaagttgataaaatttttaccgcagtggcaattgctgctaac
aaagcacgaattgaattagcaattgatgctgtaaatgaaacaaatatgggggttattgaa
gataagattattaaaaatcattatgctgctgaatatattcatcaaaaatatttgcatacc
caaacagttggggttgttaatgaaaatctgggattaggttttcaaacagtttatgaacca
gttggggtaattggagcaattattccaacaacaaatccaacagcaacggtaatttttaaa
attatgttagccttaaaaactcgtaatggaattattatttcaccacacccaggagctaaa
aattgtacaattaaaactgccaaaattttattagcagcagctgttaaagccggagctcct
aataatattattggttgaattgatgatgcgaaagttgaagatacaattgctttaatgcaa
gaagctaatttaattttagcaacgggtggtccaggaatggttaaatctgcttattcatct
ggtaaaccagcgattggcgtaggggctgggaattgtccagctattatttcaagtttagca
gatttagatatggcgacttcttcgatcattcagtcaaatatgtttgacaatggagttgtt
tgtgcaacggaaaactcagtaattgttcttgacagtgtttatgatcaagtttgtcaatat
tttactgctaagaatggttatattgttactaaaaaagaagatttagataaaattagggcg
gtaatgtttaaaaaagataactatggaattttaaatgctgctttggttggaaaaagcccg
ctccaaatcgctgaagttgctgggataacaattccccaccagacaaaattaattttatgt
gaagcgaataaaactacccatgatgaaccgcttgcccatgaaaaactatcgacctatgtt
gccttatatcgtgcaaaagattttaatagtgcgattaaaatggcaagtgatttattatta
atgggaccaggtcataccgctagtttatgaacagacgaaattagaggaaaacaagaaata
gctaaattccgtgatgagttaaacgctggacgattattagttaatatgccagcctcttta
ggtgctgttggggatatgtttaacttttatttagccccatcctttacgcttggttgtggt
agctgaggaggtaattctacctccgaaaatattcagccaaaacatttactgaatacaaaa
gttttagccttaaggagagaaaatatggaatgaattcgtttacctgaaaaaatttatcat
aaatttgggtgtttaccgtttgccttagaagatttaaaaaattggcaagcaaaaaaagtc
tttattgttactgatccagttattaataaactatatagtcacaaaataacaacagtgttg
gaaaacttaaaaattaattatgatatttttgatagtgttgaaccaaacccaacttttgca
acaacaaaaaggggagcagccgcaatggctatttcacaacctgatgttgttattgcgatt
gggggaggtagtgcaatggatgccgccaaaatcatcctattattgcatcaagatcctaat
ttaaactttgaaaacttagcaatgacatttaatgatattcgaaaaagaatcgttaaattc
ccaattattaacaatcaggtcaaactagtatgtattccgacaacagcgggaacgggctca
gaagtaacaccattctcggttattactgatgaaaaaacacacattaaatatccattggct
gattatgcattaacaccaaacattgcgattatagatccagaattaacgttaactttacca
aaacaagcaacaaatgccccagcgctagatgctttaactcatttatttgaagcttatgtt
tcggttttagcaacaacatatactgatccatattgtttgcaaggaattaaaaccattttt
gattttcttcctgatgcctaccaccatggaagcgatgatattgccgcacgctgtgcaatt
gctgatgcggcaacccaagctggaatggcttttgccaatgcttttttaggacttgttcac
tcaatgagtcataaaattgggggtaaatttaatgttattcatggttgtgccaatgccatt
ttgttaccatatgtcattcgctataatagtgctgtcatccttgatgggggtaaacaaact
tacttctcacagtataaggtggcaaatgctttagaacgttatgctactattgcccgtaat
tgtgaagttaagggtaaaaccccgagtgaattagttgataatttaattattaaaattcaa
aatttagttaaaaatgttgaaatgccattatcatttaaagaatactttgctcaatataat
ttaaaagttagcgaagatgagtttttagccgcggttgatccaatggcccaagatgctttt
gatgatcaatgtacgccagcaaatccacgtattccgttaattaaggacattaaagcaatt
tatttagatgcctactatggcaaaccagtaaaatcattacaaagtaaaaatgattag

DBGET integrated database retrieval system