KEGG   Stanieria cyanosphaera: Sta7437_0420Help
Entry
Sta7437_0420      CDS       T02406                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scs  Stanieria cyanosphaera
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sta7437_0420
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sta7437_0420
  Amino acid metabolism
   00310 Lysine degradation
    Sta7437_0420
Enzymes [BR:scs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sta7437_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(480192..481601)
Genome map
AA seq 469 aa AA seqDB search
MKQEILVPRVNTNDNEVELVHWYVEDKQFVEVGQEIADVESSKAVMSIESEASGYIVTSA
KVGDSIRVGAPLATIYTELAELEADLNGDRVVESSPSVGEPIFESVVNNGAVSTELDLAD
IRKPERDLVTTTAKPSFGFTRFSPSAKEYLKQHNLDASQFEGMGLVSVEAIEQILGKKSK
PITPANGDRSNTVITTTPTNNNLRSEKVSKAKQIEINLLSAGQAGGINSFLTVQFNSAAI
RQTLVETGSLNGQILPLILFEFSRLLEEYPVFNAYYEAGRIYYYDRIDIGLAMDLGKGLK
VPILRNSNLLSPVEIQDKVTNYATQYLDNRLDPVDLIGGTVTVTDLSNEGILHFQPLLNQ
NQAIILGIGGDSSIEGYPLTLTVVFDHRLSAGREVASFLNELKKRLLSYALSNLPETQKL
AKTKNVQCSKCLIDLHSLYQKYGSEALMQLHINEQGETDYICHVCLGGF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaatattagtcccacgagttaatacaaatgataatgaagtcgaactcgtc
cattggtatgtagaggataagcagtttgtcgaagtcggacaagaaattgccgatgtcgaa
tcctctaaagcagtaatgagtattgaatcggaagcttctggctatattgtaacttctgcc
aaagtgggagatagtatccgggttggtgcgcctctggctactatttatacagaactagcg
gaattagaagcagatttaaacggcgatagggtggtagaatcctctccttctgttggcgaa
cccatttttgaatcagttgttaataatggtgctgtttcaactgagttagatttagcagac
atcagaaaacccgaacgggatttagtaactaccacagctaaaccatcttttggttttacc
cgtttttctccttcagctaaagaatacctcaaacagcataatctcgatgccagtcagttt
gaaggcatgggtttagtttctgtcgaggcgattgagcaaattttgggcaaaaaatctaaa
cctataactcctgccaatggcgatcgctcaaatacggtaattactaccactcctactaac
aataatctccgttctgaaaaagttagtaaagccaagcaaattgaaatcaacttactcagt
gcagggcaagcaggaggaattaatagtttcttaaccgtgcaatttaattcggctgctatt
aggcaaactttggttgaaactggctcgcttaacggtcaaatcttacctttaattctgttt
gaattttctcgcctcttagaagaatatcccgtttttaatgcctattatgaagcagggaga
atttattattatgatcgcattgacattggcttagcgatggatttaggcaaaggcttgaaa
gttcccatccttcgcaattccaatctgctgtctcctgtagaaatacaagataaagttact
aactacgctactcagtatctagataatcgcctcgatcctgttgatttaataggaggaact
gttaccgtaaccgatctttccaatgaaggaattctgcattttcaacctttgctgaatcaa
aatcaagcaattattctgggtattggcggagatagtagtattgaaggttatccgctcact
ttaactgtcgtattcgatcatcgtctttctgcgggaagagaggtagcttctttcctcaac
gaattaaaaaaacgccttctaagctacgctttatcgaacttacccgaaacacaaaagcta
gcaaaaacgaaaaacgtgcaatgcagtaagtgtttaatcgatttgcattctttatatcaa
aaatatggctcggaagctttaatgcaacttcacattaacgaacaaggggaaaccgattat
atctgtcacgtttgtttaggaggattttaa

DBGET integrated database retrieval system