KEGG   Stanieria cyanosphaera: Sta7437_0420Help
Entry
Sta7437_0420      CDS       T02406                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
scs  Stanieria cyanosphaera
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:scs01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:scs00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:scs00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(480192..481601)
Genome map
AA seq 469 aa AA seqDB search
MKQEILVPRVNTNDNEVELVHWYVEDKQFVEVGQEIADVESSKAVMSIESEASGYIVTSA
KVGDSIRVGAPLATIYTELAELEADLNGDRVVESSPSVGEPIFESVVNNGAVSTELDLAD
IRKPERDLVTTTAKPSFGFTRFSPSAKEYLKQHNLDASQFEGMGLVSVEAIEQILGKKSK
PITPANGDRSNTVITTTPTNNNLRSEKVSKAKQIEINLLSAGQAGGINSFLTVQFNSAAI
RQTLVETGSLNGQILPLILFEFSRLLEEYPVFNAYYEAGRIYYYDRIDIGLAMDLGKGLK
VPILRNSNLLSPVEIQDKVTNYATQYLDNRLDPVDLIGGTVTVTDLSNEGILHFQPLLNQ
NQAIILGIGGDSSIEGYPLTLTVVFDHRLSAGREVASFLNELKKRLLSYALSNLPETQKL
AKTKNVQCSKCLIDLHSLYQKYGSEALMQLHINEQGETDYICHVCLGGF
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagaaatattagtcccacgagttaatacaaatgataatgaagtcgaactcgtc
cattggtatgtagaggataagcagtttgtcgaagtcggacaagaaattgccgatgtcgaa
tcctctaaagcagtaatgagtattgaatcggaagcttctggctatattgtaacttctgcc
aaagtgggagatagtatccgggttggtgcgcctctggctactatttatacagaactagcg
gaattagaagcagatttaaacggcgatagggtggtagaatcctctccttctgttggcgaa
cccatttttgaatcagttgttaataatggtgctgtttcaactgagttagatttagcagac
atcagaaaacccgaacgggatttagtaactaccacagctaaaccatcttttggttttacc
cgtttttctccttcagctaaagaatacctcaaacagcataatctcgatgccagtcagttt
gaaggcatgggtttagtttctgtcgaggcgattgagcaaattttgggcaaaaaatctaaa
cctataactcctgccaatggcgatcgctcaaatacggtaattactaccactcctactaac
aataatctccgttctgaaaaagttagtaaagccaagcaaattgaaatcaacttactcagt
gcagggcaagcaggaggaattaatagtttcttaaccgtgcaatttaattcggctgctatt
aggcaaactttggttgaaactggctcgcttaacggtcaaatcttacctttaattctgttt
gaattttctcgcctcttagaagaatatcccgtttttaatgcctattatgaagcagggaga
atttattattatgatcgcattgacattggcttagcgatggatttaggcaaaggcttgaaa
gttcccatccttcgcaattccaatctgctgtctcctgtagaaatacaagataaagttact
aactacgctactcagtatctagataatcgcctcgatcctgttgatttaataggaggaact
gttaccgtaaccgatctttccaatgaaggaattctgcattttcaacctttgctgaatcaa
aatcaagcaattattctgggtattggcggagatagtagtattgaaggttatccgctcact
ttaactgtcgtattcgatcatcgtctttctgcgggaagagaggtagcttctttcctcaac
gaattaaaaaaacgccttctaagctacgctttatcgaacttacccgaaacacaaaagcta
gcaaaaacgaaaaacgtgcaatgcagtaagtgtttaatcgatttgcattctttatatcaa
aaatatggctcggaagctttaatgcaacttcacattaacgaacaaggggaaaccgattat
atctgtcacgtttgtttaggaggattttaa

DBGET integrated database retrieval system