KEGG   Stanieria cyanosphaera: Sta7437_0511Help
Entry
Sta7437_0511      CDS       T02406                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
scs  Stanieria cyanosphaera
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sta7437_0511
   00052 Galactose metabolism
    Sta7437_0511
   00500 Starch and sucrose metabolism
    Sta7437_0511
   00520 Amino sugar and nucleotide sugar metabolism
    Sta7437_0511
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sta7437_0511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590749..591645)
Genome map
AA seq 298 aa AA seqDB search
MSQKKVRKALIPAAGFGTRLFPATKIVKKELFPIIDRDGRAKPIIMAIVEEAINAGIEEV
GIVVQPEDRELFTDLFKAPPKPELFKKLSPENQKYSQYLQDLGKQITILIQTEQEGYGHA
VYCAKDWVDQESFLLLLGDHVYTTNTERSCAKQMLDVYQQFEQNIIGLTIMSAEIIHKAG
CVTGVWQQPNSLLKITEIYEKPSLEYARQNLKVNGMKKDEFLGVFGMYILESKIFDLLEE
DINHNYRFKGEFQLTTCLDKLRQEQATLGYLVQGQYFDTGMPLFYRQTMIDFYQNSKN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaaagaaagtccgtaaagccttaattcctgctgctggttttggtactcgatta
tttccagctacaaaaattgtcaaaaaagaattgtttccgattattgatcgtgatggacga
gccaaaccaattattatggcaattgtagaagaagcaattaatgcagggatagaagaagtt
ggaattgtcgttcaaccagaagatcgagaattatttactgacttgtttaaagctccacct
aaaccagaattatttaaaaaattgtctcctgaaaatcagaaatacagtcaatatttacaa
gatttaggtaaacaaattactattctgattcaaacagaacaagaaggatatggtcatgca
gtttattgtgctaaagattgggttgatcaagaatcttttttattgttactaggcgatcat
gtttatacaactaatacagagcgttcttgtgctaaacaaatgcttgatgtttatcaacaa
tttgaacaaaatattattggtttgacgatcatgtcagccgaaatcatccacaaggcaggt
tgtgttactggtgtttggcaacagccaaattcgcttttaaaaataactgaaatatatgaa
aaaccaagtttagaatatgctcgtcaaaatttaaaagttaacggaatgaaaaaggatgaa
tttttaggcgtatttggaatgtatattcttgagtcaaaaatttttgatttactagaagag
gatattaatcataactatcgatttaaaggagaatttcagttaactacttgcttagataaa
ttacgtcaagagcaagctacactcggttatttagttcaaggacaatattttgatacagga
atgcctttgttttatcgtcagactatgattgatttttatcagaattctaaaaactaa

DBGET integrated database retrieval system