KEGG   Stanieria cyanosphaera: Sta7437_0856Help
Entry
Sta7437_0856      CDS       T02406                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
scs  Stanieria cyanosphaera
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:scs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(945314..946108)
Genome map
AA seq 264 aa AA seqDB search
MLELYQFELSQYSEKVRLILDYKGLEYRKIEVTPGVGQIELMQKTGKRQVPVLKDGDTYV
ADSTAIAFYLDQKYPERPIIPDDPVARGQCLLIEEWADESIGIKGRKALIGALNQNQNFR
TAVLPKQTPDFLKTLVSAIPGDLLDVLGTGVGLGGDAVKEAKKGLQQDLEALCLILENRP
YLVGDTPTLADLAVAGLTMILKFPEGSYLDLPEQLKGKGIPGLADNIAYEPFFTWRDRLY
ADYRKASGSPNKNNGSAPTAINID
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagctataccaatttgaattatctcaatattcagaaaaagtacgtctgatttta
gattacaagggtttagaatatcgcaaaattgaagttactcctggcgttggacaaatagaa
ctaatgcaaaagactgggaaaagacaagtaccagttttaaaagatggtgatacctatgtg
gctgactcaacagcgatcgctttttatctagatcagaaatatccagagcgaccaattatt
cctgacgatcctgtagcgagagggcagtgtttattaattgaagaatgggcagatgaatcg
attggcatcaaaggcagaaaagctttaattggtgctttaaatcaaaatcaaaactttcgt
accgcagttttacccaaacaaactcctgatttcctcaaaactttagtaagtgctattcct
ggagatttattagatgttttaggtactggagtcggtttaggtggtgatgcggttaaagaa
gccaaaaaaggactacaacaagatttagaagccctttgtttaattttagaaaatcgcccc
tatttagtcggtgatactcctactttggcagatttggcagtagcaggattaactatgatc
ctcaaattccctgaaggttcttatctcgatcttcccgaacaactcaaaggtaaaggtatt
ccagggttagcagataatatcgcttacgaacccttctttacttggcgcgatcgcttgtat
gcagattaccgcaaagcttctggtagtcctaacaaaaataatggttctgcaccaacggca
atcaacatagattaa

DBGET integrated database retrieval system