KEGG   Stanieria cyanosphaera: Sta7437_0885Help
Entry
Sta7437_0885      CDS       T02406                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
scs  Stanieria cyanosphaera
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sta7437_0885
Enzymes [BR:scs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sta7437_0885
Exosome [BR:scs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sta7437_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(975299..977020)
Genome map
AA seq 573 aa AA seqDB search
MQWANIPNIFKLIHPVSTGVLKRKMASSIEFQLFAPYNKEANLIGSFSDWEPIKMEKGDD
GYFRNKVELEDGEYRYKFQVRSKSWFLEPDQWVDIIDPYATDIDEYTQNGILKIKEGKKI
VDTYVWQHDDKPLPADHELVIYELHVGDFSGGEDDPKIRGRYQHVTEKLDYLIDLGINAI
ELMPVKENPGEYSWGYSPQHFFAAESNYGSTYELKRLIDECHAKGIRVIMDGIYNHTNTD
CPLTQIDHDYWFHHEPTDPDNSWGPEFNYEHYDENLDLKPAWQFVGDTVDYWVKEYHIDG
IRYDAARQLDNYDFMHWIVNRTKEVAGSKPFYNIAEHIPENPAITNLDGPMDGCWHDSFY
HTVKAHICGDRFELEELKNVIDCKRQGFLGATNVVNYLTNHDHERIMAELADRSIFDEAA
FKRFKLGVALLMTAVGIPMVWMGEEFGDYHPLSQESNKIDWNLLKNDLNSGLQAYYKGLI
NLRKHNYALYTENIEFFYEDPEAKVFAYTRWNDEGSRVVVVANFSDQYLAGYTIPNFPDN
GTWHEWTGDYDIEAGENQIMIDLPEYEAKVFVK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggcaaatatccccaatatatttaaacttatccaccctgtctccactggggta
ttgaaaagaaagatggcaagttcaatagaatttcaattattcgctccctataataaagaa
gctaacctcattggttctttttccgattgggaaccaattaagatggaaaaaggtgatgac
ggttattttagaaataaagtagaacttgaagatggtgaatatcgctataaattccaagtt
cgttccaaaagttggtttctcgaaccagaccaatgggtagatattattgatccttatgca
actgatattgacgaatatactcaaaatggaattctaaagattaaagaaggcaaaaaaatt
gttgatacctacgtctggcaacacgatgataaacctttacctgccgaccatgaattagta
atctatgaactgcacgtaggcgacttttctggtggggaagatgacccgaaaattcgaggt
cgatatcaacacgttaccgaaaaattagattatttaatagatctggggatcaatgccatt
gaattgatgcctgtcaaagaaaatcctggtgagtatagttggggttatagtccacaacac
ttttttgctgctgaatctaattatggttctacctatgaactaaagcgtctgattgatgaa
tgtcatgctaaaggcatccgagtgattatggatgggatttacaatcacaccaataccgat
tgtcctttgactcaaatcgatcatgattattggtttcatcacgaacccactgaccccgat
aatagttggggcccagaatttaactacgaacattatgacgaaaatttagacctcaaacca
gcttggcaattcgtcggcgatacagttgattattgggtgaaagaatatcatatcgatggc
atccgttacgatgctgcccgccaactcgataattacgattttatgcattggattgttaat
cgcactaaagaagttgcaggcagcaaacccttttataacatcgccgaacatattcccgaa
aatcctgccattactaacttagatggaccaatggacggctgttggcatgatagcttttat
cataccgtgaaagctcatatctgtggcgatcgctttgagctagaagaattaaaaaatgtg
attgattgcaaacgtcaaggttttttgggtgcaactaatgtagtcaattacttaactaac
catgaccacgaacgcatcatggcagagttggcagatcgtagtatctttgatgaagcagcc
ttcaaacgatttaagttgggtgtagctttgttaatgactgccgttggtataccaatggtt
tggatgggcgaggaatttggtgattatcatcctctcagccaagaatctaacaaaattgat
tggaatcttctcaaaaatgaccttaatagtggtttacaggcatattataaaggtttaatt
aatttaagaaaacacaattacgctctttatactgaaaatattgaatttttctacgaagac
cctgaggcaaaagtatttgcttatactcgttggaacgatgaaggttctagagtcgttgta
gtagccaatttttctgaccaatatttagctggttataccatacccaattttccagataat
ggaacttggcatgaatggacaggcgactatgatatcgaagctggagaaaatcaaattatg
atcgatcttccagaatacgaagctaaagtctttgtcaaataa

DBGET integrated database retrieval system