KEGG   Stanieria cyanosphaera: Sta7437_0965Help
Entry
Sta7437_0965      CDS       T02406                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
scs  Stanieria cyanosphaera
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sta7437_0965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_0965
   00052 Galactose metabolism
    Sta7437_0965
   00500 Starch and sucrose metabolism
    Sta7437_0965
   00520 Amino sugar and nucleotide sugar metabolism
    Sta7437_0965
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sta7437_0965
   00524 Butirosin and neomycin biosynthesis
    Sta7437_0965
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sta7437_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1073108..1074208)
Genome map
AA seq 366 aa AA seqDB search
MLLLIGDIGGTKTILRLVEVAEQVQSIETIQQANYRGTKTILRLVEIAEQVQSFETIQQA
NYSSSSFCDLVPMVKEFLARVESKAPQRACFAIAGPVINNSSTLTNLNWHLDSKRLEQEL
NLEKVDLINDFAANSYGVLALKESDLYPLQIGQSQPSSPIAVIGAGTGLGEGFLIPQGRF
YQVFATEGGHTDFAPRNDLEMQLLQYLQHKLNTEHISVERVVSGQGIVAIYQFLRDSNYA
AESPEISAKILNWEQQKSPKIDPAAIISQGARVSGDRLCQKTMAMFVEAYGAEVGNVALK
LLPYGGIYLTGGVAIKNLEIMSDGRFLASFKQKGRVSFLLENIPINLVNNVQVGLLGSIL
YALQFV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttattgctgattggagacattggtggaacaaaaactatcttgcgtctggtagaagta
gcagaacaagttcaatccattgaaacaattcaacaagctaattatcgtggcacaaagact
atcttgcgtttggtagaaatagcagaacaagttcaatcttttgaaacgattcaacaagct
aattactctagtagttccttttgcgatcttgtcccaatggtaaaagagtttttagctaga
gtagaatcaaaagcaccacaaagagcttgttttgcgatcgcaggaccagtaattaataat
tcctctaccttaactaatcttaattggcatctagatagtaaaagattagaacaagaatta
aatcttgaaaaagtcgatctaattaatgactttgctgctaatagttatggggttttagct
ttaaaagaatctgatttatatcctttacaaatcggtcaatctcaaccatctagtcccatt
gctgtaataggtgcaggtacgggtttaggagaaggatttttaataccccaaggcagattt
tatcaagtttttgcgaccgaaggaggacacacagattttgctcctcgcaatgacttagag
atgcaacttttacaatatcttcaacataaattaaatacagaacatatttctgtagaacga
gtagtatcgggtcagggaattgtcgcaatttatcaatttttacgagattctaattatgct
gctgaatcaccagaaataagtgcaaaaattttgaattgggaacaacaaaaaagtccaaaa
atcgatcctgctgcaattatttctcaaggtgcaagagtttcaggcgatcgcctttgtcaa
aaaacaatggcaatgtttgttgaagcttatggagcggaagtaggtaatgtagctttaaaa
ttattaccttatggtggtatttatctgactggtggtgtggcaattaaaaatctagaaatc
atgtcagatggtcgctttctagctagttttaaacaaaagggtagagtaagttttttatta
gaaaatattccaatcaatttagttaataatgtccaagtcggattattaggctcaatttta
tatgctctacaatttgtttaa

DBGET integrated database retrieval system