KEGG   Stanieria cyanosphaera: Sta7437_0965Help
Entry
Sta7437_0965      CDS       T02406                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
scs  Stanieria cyanosphaera
Pathway
scs00010  Glycolysis / Gluconeogenesis
scs00052  Galactose metabolism
scs00500  Starch and sucrose metabolism
scs00520  Amino sugar and nucleotide sugar metabolism
scs00521  Streptomycin biosynthesis
scs01100  Metabolic pathways
scs01110  Biosynthesis of secondary metabolites
scs01120  Microbial metabolism in diverse environments
scs01130  Biosynthesis of antibiotics
scs01200  Carbon metabolism
Module
scs_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:scs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sta7437_0965
   00052 Galactose metabolism
    Sta7437_0965
   00500 Starch and sucrose metabolism
    Sta7437_0965
   00520 Amino sugar and nucleotide sugar metabolism
    Sta7437_0965
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sta7437_0965
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sta7437_0965
Enzymes [BR:scs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sta7437_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF2740
Motif
Other DBs
NCBI-ProteinID: AFZ34547
UniProt: K9XSA2
Position
complement(1073108..1074208)
Genome map
AA seq 366 aa AA seqDB search
MLLLIGDIGGTKTILRLVEVAEQVQSIETIQQANYRGTKTILRLVEIAEQVQSFETIQQA
NYSSSSFCDLVPMVKEFLARVESKAPQRACFAIAGPVINNSSTLTNLNWHLDSKRLEQEL
NLEKVDLINDFAANSYGVLALKESDLYPLQIGQSQPSSPIAVIGAGTGLGEGFLIPQGRF
YQVFATEGGHTDFAPRNDLEMQLLQYLQHKLNTEHISVERVVSGQGIVAIYQFLRDSNYA
AESPEISAKILNWEQQKSPKIDPAAIISQGARVSGDRLCQKTMAMFVEAYGAEVGNVALK
LLPYGGIYLTGGVAIKNLEIMSDGRFLASFKQKGRVSFLLENIPINLVNNVQVGLLGSIL
YALQFV
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttattgctgattggagacattggtggaacaaaaactatcttgcgtctggtagaagta
gcagaacaagttcaatccattgaaacaattcaacaagctaattatcgtggcacaaagact
atcttgcgtttggtagaaatagcagaacaagttcaatcttttgaaacgattcaacaagct
aattactctagtagttccttttgcgatcttgtcccaatggtaaaagagtttttagctaga
gtagaatcaaaagcaccacaaagagcttgttttgcgatcgcaggaccagtaattaataat
tcctctaccttaactaatcttaattggcatctagatagtaaaagattagaacaagaatta
aatcttgaaaaagtcgatctaattaatgactttgctgctaatagttatggggttttagct
ttaaaagaatctgatttatatcctttacaaatcggtcaatctcaaccatctagtcccatt
gctgtaataggtgcaggtacgggtttaggagaaggatttttaataccccaaggcagattt
tatcaagtttttgcgaccgaaggaggacacacagattttgctcctcgcaatgacttagag
atgcaacttttacaatatcttcaacataaattaaatacagaacatatttctgtagaacga
gtagtatcgggtcagggaattgtcgcaatttatcaatttttacgagattctaattatgct
gctgaatcaccagaaataagtgcaaaaattttgaattgggaacaacaaaaaagtccaaaa
atcgatcctgctgcaattatttctcaaggtgcaagagtttcaggcgatcgcctttgtcaa
aaaacaatggcaatgtttgttgaagcttatggagcggaagtaggtaatgtagctttaaaa
ttattaccttatggtggtatttatctgactggtggtgtggcaattaaaaatctagaaatc
atgtcagatggtcgctttctagctagttttaaacaaaagggtagagtaagttttttatta
gaaaatattccaatcaatttagttaataatgtccaagtcggattattaggctcaatttta
tatgctctacaatttgtttaa

DBGET integrated database retrieval system