KEGG   Stanieria cyanosphaera: Sta7437_1020Help
Entry
Sta7437_1020      CDS       T02406                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
scs  Stanieria cyanosphaera
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sta7437_1020
DNA repair and recombination proteins [BR:scs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sta7437_1020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125142..1125702
Genome map
AA seq 186 aa AA seqDB search
MQLLPGVGPKTAQRLALHLIKRSEKEVQSLAQALIDAKKQVGLCKVCFHLSAEPVCSICS
NQNRDRDTICVVADSRDVIALEKTREYKGQYHVLGGVISPMDGIGPEQLHIEALVRRVTK
NQVKEVILAINPSVEGETTTLYLGGLLKPFTKVTRIAFGLPMGGDLEYADEVTLARALEG
RRELDF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
ttgcagttattacctggagttggaccaaaaactgctcaaagattagccttacatctgatt
aagcgttcagaaaaagaagtacaatccttagcacaagctttaattgatgccaaaaaacaa
gtaggcttgtgtaaagtctgttttcatttgtcggcagaaccagtttgttcaatctgtagc
aatcaaaatcgcgatcgcgatactatttgtgtagtggctgattctcgtgatgtgatcgct
ttggaaaaaacaagggaatacaagggtcagtatcacgttttgggtggcgtaatttcaccc
atggatggaattgggccagaacagctacatattgaagctttagtgagaagagttactaaa
aatcaagttaaagaggttattttggcaattaatcctagtgttgaaggagaaactacaact
ctctatctcggtggattgttaaaaccgtttactaaagtgactcgaattgcttttggttta
ccgatgggtggggatttggaatatgctgatgaagttactcttgctagggcattagaaggt
agaagagaattagatttttag

DBGET integrated database retrieval system