KEGG   Stanieria cyanosphaera: Sta7437_1097Help
Entry
Sta7437_1097      CDS       T02406                                 

Definition
Protein-arginine deiminase (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
scs  Stanieria cyanosphaera
Brite
Enzymes [BR:scs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     Sta7437_1097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205237..1207231
Genome map
AA seq 664 aa AA seqDB search
MRRFFPTKTLNNCHSSSQETHQEYEDIIVVDQPMQISLNNLAPSDQAIVSFKTRGEIEVY
SSTNQLITSLNPVPVREIPEITLLARTFSDRILDRCLQITFQDDACCQLSQVLIKLTCVR
ICLDVDADRDGVIEEDHPHKGDWQWGINGHGAVLLVNNDRGLNYSDEQQKQEDQSIQRLL
ALKDLSFMSVRRVGLKKLPAECQLCLSVDQDIAKRIRIYDQLEQRGDQLIGSGKATAQLK
DTDRDIILAIEGLSYPDFDFDGMVEITLSLVKQGEILYSDRVIFRVAPWIMTPNTLAPIT
VFVSRLSNGKNEQFIDELRKVVGKANAQIDPVPFEFHQDDPWMRDEIEIGYTQAPGHFIH
VILDSPRDRGLDHFAQRQLIGTDFGYVVRKSRYCATKLDSFGNLEVSPPVTVNGINYPFG
RLIFGGTRPEIIHQPRRMLKVVRDFLYAQKIQAPLEIFSDWLSVGHIDEFMTFVPASTSK
GFKLLLASTDKSYELLKQLRDQGQAQILLRQGKQLNDQPADISVADVLNNQELTSQNQRF
QEYINWNREVLKQELGLDEEDIIDIPALFQDDGDGRAETFFPNMVNLIVLNQHLAIPKPF
GPKIKDQCQFEAYVKRVLEPLGKECHFIDDWEPYFRGGGEIHCGTNTRRQPFTQKWWEIE
PNFL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagacgttttttccccactaaaacacttaataactgtcactcaagttctcaagaaaca
caccaagagtatgaagatattattgttgtagatcagccaatgcaaatttctttaaacaat
cttgcaccttccgatcaagcaatagttagttttaaaacacgaggagaaatcgaagtttac
tctagcacaaaccaactgattactagcttaaatcctgttcctgttagggaaataccagaa
attactttactagcgagaacttttagcgatcgcattttagaccgttgtttacaaataact
tttcaagatgatgcttgttgtcaactaagtcaagttttaatcaaactaacctgtgtgcga
atttgtttagatgtggatgcggatcgagatggggtaattgaagaagatcatccccataaa
ggagattggcaatgggggattaatggccatggtgcagtcttattagtcaataatgatcgc
ggtcttaattattccgatgagcaacagaaacaagaagatcaatctattcaaagactacta
gctctcaaagatttgagctttatgagtgttcgtcgagttggcttaaaaaagttacctgcc
gagtgtcaactttgcctgtcagtcgatcaagatattgctaaacgtattcgtatttatgat
caattagagcaaagaggagatcagttaattggttcgggaaaagcaacagcccaacttaag
gatacggatcgagacattatcctagctattgaaggactcagttatcctgattttgatttc
gatggcatggttgagattactttaagtctggtgaaacagggagaaatactctacagcgat
cgcgtaatttttcgagtcgcaccttggatcatgactcctaataccttagctccaattact
gtttttgtttctcgtttatcaaatggaaaaaacgaacaatttatcgacgaactcagaaaa
gttgtcggcaaagccaatgcacaaatagatcctgttccttttgagtttcatcaagatgat
ccttggatgcgagacgaaattgaaattggttacactcaagcacctggacacttcatacac
gtaatacttgattcaccacgcgatcgcggattagatcattttgctcaacgtcaattaatc
ggaactgattttggttatgtagttcgcaaaagtcgttattgcgcgacaaaattagattct
tttggcaatttagaagtttctccaccagtaaccgtaaatgggattaattatccctttggt
cgtctaatctttggaggaacacgtccagaaattattcatcaaccgcgtcgtatgttaaaa
gttgtgcgggattttctttacgctcaaaaaattcaagcccccttggaaatcttttccgat
tggttaagtgtaggacatatagacgaattcatgacttttgttcctgcatcaacaagtaaa
ggatttaaattacttctagctagtactgacaagtcttatgagcttcttaaacagttacgc
gatcaaggacaggctcagatattgttacgacaaggaaaacaacttaatgaccaacctgct
gatattagtgtggcagatgttctcaataatcaagagttaactagccaaaaccaacgtttt
caagaatatattaactggaatcgagaggttttgaaacaggaattaggtttagatgaggaa
gatattatcgacatacctgctttgtttcaagatgatggcgatgggcgtgccgaaaccttt
tttcccaacatggtcaatctaatcgttctcaatcagcatcttgctattcccaaaccattc
gggccaaaaatcaaggatcaatgtcaatttgaagcttatgttaaaagagttttagaacct
ttgggtaaagaatgtcactttattgatgattgggagccttattttcgcggtggtggagaa
attcattgtggtactaataccagacgacaaccgtttactcaaaaatggtgggaaattgaa
ccgaattttctttag

DBGET integrated database retrieval system