KEGG   Stanieria cyanosphaera: Sta7437_1401Help
Entry
Sta7437_1401      CDS       T02406                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
scs  Stanieria cyanosphaera
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:scs00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sta7437_1401
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sta7437_1401
Enzymes [BR:scs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sta7437_1401
Two-component system [BR:scs02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Sta7437_1401
Bacterial motility proteins [BR:scs02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sta7437_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552094..1553122
Genome map
AA seq 342 aa AA seqDB search
MNNHHIITIGTSAGGIRALKTLVSQLPKDFPASIHIVQHLPSESRSNLPQILNKAGQLPV
AFAKDGELIESGRIYLAPPDFHMTLEKNYIRVIRGPRENRVRPAVDPLFRSAAVTYKSYV
TGVILTGMLDDGTAGLQAIKTCGGMAIVQDPDEAEFNSMPKSAIANVEVDWVVPLSGIAN
ILIERVRQTPPMITEIPENLRIEASITKNGITEPEIMDRIGQPVFSSCPSCGGRLWQIGH
NSPLRYRCHTGHAFTSSTLLTEQNEATEKALWIALRTLEERGRLLENMSKQYAQKGSNNL
ANIHQARSQEAFEHAMLIRNLIYNLKDISVFSTEEKPKQETS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgaacaatcatcatattattaccattggtacatcggctggggggatacgagccttaaaa
actctggtaagtcagttaccaaaagattttccagcttcaatacatattgtgcagcatctt
cccagcgaatctcgtagcaatttgcctcaaattttaaacaaagctggtcaacttcccgtt
gcctttgcgaaagatggagaactgattgagtctggtcgtatttatttagcacctcctgat
tttcacatgacgttagaaaaaaactatatcagagtgatccgtggtcctcgcgagaatcga
gtgcgacctgctgttgatccactttttcgctcggctgccgtaacttataaatcctatgta
acgggtgtgattctgacgggaatgttagatgatggtactgctggactacaagcgattaaa
acttgtggcggaatggcaattgtccaagacccagatgaagcagaatttaatagtatgccc
aaaagtgcgatcgctaatgtcgaagtagattgggttgttcctttaagcggtatagctaat
attttgattgaacgagttcgccaaactccacctatgatcacagaaattcctgaaaatttg
cggatagaagcctcaattacgaaaaatggcatcaccgaaccagaaattatggatcgaatt
ggtcaacctgttttctcaagttgtcctagttgcggaggtcgtttatggcaaattggtcac
aattcgcctctgcgttatcggtgtcatactggtcatgcttttacaagcagtactttactt
acagaacagaatgaagcaactgaaaaggcactttggatcgcactgcgaactttagaagaa
cgaggtcgtctcttagaaaatatgagcaagcaatatgctcaaaaaggttctaacaaccta
gcaaatatccatcaagcacgttctcaagaagcatttgaacacgctatgcttatccgtaat
ttaatttacaatctcaaagatatttcagtattttctaccgaagagaaacctaaacaagaa
acttcgtga

DBGET integrated database retrieval system